These 1,193,690 images need to be put on the map. Can you help pin their Where?

Image from page 140 of
Description: Identifier: athletictraining00orto Title: Athletic training for school boys Year: 1910 (1910s) Authors: Orton, George W., b. 1873, ed Subjects: Athletics Publisher: New York, American Sports Pub. Co Contributing Library: The Library of Congress Digitizing Sponsor: Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: Edited by J. E. Sullivan Secretary - Treasurer of the Amateur Athletic Union of theUnited States RECORDS Running High Jumping Walking Broad Jumping Shot Putting Throwing the Hammer Throwing the Discus Three-Legged Race Sack Racing Javelin Kicking Lifting Long Dive Marathon Road Races Parallel Bar Relay Racing Rope Climbing Running Backwards Running the Bases Skating Stone Gathering Pole Vaulting Winners in Olympic Games Womens Athletic Records PROMPT ATTENTION GIVEN TO I ANY COMMUNICATIONS ADDRESSED TO US A.G.SPALDING &. BROS. STORES IN ALL LARGE CITIES FOR COMPLETE LIST OF STORES SEE INSIDE FRONT COVER OF THIS BOOK Eliixi iiugeil Januanj 5,L910^ ^ulject to ihange Viilhqui notict. for Cono^an JfOSLKe^peeia/ Canadian Catalpgut. 9^;^S^ SSUHE$RALDING(tJ)TRADEMARK Z^ SPALDINGS ATHLETIC LIBRARYGROUP XIL- No. 331. SchoolyardAthletics By J. E. SULLIVAN President Amateur Athletic Union;Member Board of Education Greater New York. Text Appearing After Image: THE great interest in ath-letics that has developed in the public schoolswithin recent years has led tothe compilation of this bookwith a view to the systemiza- tion of the various events that form the distinctivelyathletic feature of school recreation. With its aid any,teacher should be able to conduct a successful meet, whilethe directions given for becoming expert in the variouslines will appeal to the pupil. Some of the leadingathletes have contributed chapters on their specialties:Ray Ewry, holder of the worlds high jump record, tellshow to practice for that event; Harry Hillman, holder ofthe hurdle and three-legged records, gives hints on hurdleracing and three-legged racing; Martin Sheridan, all-around champion of America, gives directions for puttingthe shot; Harry F. Porter, high jump expert, describeshow to become proficient in that event. The book isillustrated with photos taken especially for it in publicschool yards. PRICE 10 CENTS PROMPT ATTENTION GIVEN TO ANY COMMUNICAT Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 12613
Tags: bookcentury1900 bookdecade1910 bookyear1910 bookpublishernewyorkamericansportspubco bookidathletictraining00orto bookauthorortongeorgewb1873ed booksubjectathletics bookcontributorthelibraryofcongress booksponsorsloanfoundation bookcollectionamericana
1910

Image from page 32 of
Description: Identifier: studiesinprimiti00roth Title: Studies in primitive looms Year: 1918 (1910s) Authors: Roth, H. Ling (Henry Ling), 1854-1925 Royal Anthropological Institute of Great Britain and Ireland. Journal Subjects: Weaving Publisher: Halifax [Eng.] F. King & sons, ltd Contributing Library: Sterling and Francine Clark Art Institute Library Digitizing Sponsor: Sterling and Francine Clark Art Institute Library View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: an attached cord (Fig. 34), and the temple (Fig. 37) consistsof a piece of hollow cane with a loose very thin piece of cane running through it,the protruding ends of which are stuck into the finished portion of the web, practi-cally similar to that of the above-mentioned Kachiquel loom. The dimensions are : NMVA (ANCIENT MEXICAN) £*M-WE.AV1N02A CODEX . Kl MC-S-^O^OUS-H VOL. I. PL .6l._ NOTE THe %\TOF WEAVING ATTHE. WARP 6N.P A. 1 Doubled is a terra used to denote two or more threads twisted into one, and known astwo-ply, three-ply, six-ply, etc. H. Ling Eoth.—Studies in Primitive Looms. 21 length, beam to beam inclusive, about 14 feet (or 425 m.); width of web,17£ inches (or 44-5 cm.); 64 warps to the inch (or 25-6 to the cm.); the warps aresisters, same as the Kachiquel warp; 25 picks to the inch (or 10 to the cm.); thewefts are single. Both warp and weft are continuous. The spool is of the primi-tive longitudinal type {Ad). The shed-stick is a palm midrib or stem. Text Appearing After Image: 4. A very interesting loom (Plate I) is that brought from Mazatec, Arizona,by J. Cooper Clark, and now in the British Museum ; for besides the plain up-and-down web, a large portion is devoted to twist or gauze1 weaving, while a consider-able piece of the plain web is afterwards covered by a woven-in design of dark blue 1 Gauze, formed by crossing adjacent warp threads and bound by weft at the point ofjunction. h 2 22 H. Ling Eoth.—Shtclies in Primitive Zooms. wool. Beginning at the breast beam, there are 10 plain picks, then 1 of gauze,then 4 more plain picks, whence the gauze weaving extends a length of about8^ inches (or 22 cm.), and on this is woven the pattern just mentioned; then wehave a further 6 5 cm. (or 2f inches) of gauze; then 14 cm. (or A^ inch) of plainweaving, followed by 76 cm. (or 3 inches) of gauze, and soon. The wTarp lay-outfor accomplishing the gauze is shown in Fig. 41. It should be noted that on thisloom, as on the Kachiquel loom, a piece of the tailing has b Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 1195
Tags: bookcentury1900 booksubjectweaving bookdecade1910 bookidstudiesinprimiti00roth bookauthorrothhlinghenryling18541925 bookauthorroyalanthropologicalinstituteofgreatbritainandirelandjournal bookpublisherhalifaxengfkingsonsltd bookyear1918 bookleafnumber32 bookcontributorsterlingandfrancineclarkartinstitutelibrary
1918

Image from page 1150 of
Description: Identifier: rodguncan15cana Title: Rod and gun Year: 1898 (1890s) Authors: Canadian Forestry Association Subjects: Fishing Hunting Outdoor life Publisher: Beaconsfield, Que. [etc.] Rod and Gun Pub. Co. [etc.] Contributing Library: Gerstein - University of Toronto Digitizing Sponsor: University of Toronto View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: through the dark clouds. Findingthese strenuous efforts unavailing the fishdived to the bottom and sulked. When asalmon does this he is usually dislodged fromhis position by throwing stones in the waterdirectly over him, for it is only by keepinga fish on the move that he can be tired to suchan extent that he can be brought closeenough to the shore to be hooked with the gaff.Johnny and Grandpa stoned the salmon whichonce more took up the brave but uselessstruggle. Grandpa is a pastmaster at playinga fish and soon had the salmon so close to shorethat Grandma landed him with the gaff. ■flu sun had now set. The shades of even-ing were falling. The Majestic oaks thatstand like giant sentinels along the rivers banktook on a darker hue. The air, if possible,became more chilly. The two oldei people andthe little boy started proudly homewardtaking with them as the result of an hoursfishing two handsome salmon, one of whichweighed 10 pounds and the other 12 pounds. ROD AND GUN IN CANADA 1299 Text Appearing After Image: Pocock Bros.g^ ■ i : ■■1:^, IHE ONLY HOUSE FOR CRICKET, TENNIS,^jFOOTBALL Running Shoes, BoxingGloves, Punching Balls Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 951
Tags: booksubjecthunting bookcentury1800 bookdecade1890 booksubjectfishing bookyear1898 booksubjectoutdoorlife bookauthorcanadianforestryassociation bookpublisherbeaconsfieldqueetcrodandgunpubcoetc bookidrodguncan15cana bookleafnumber1150
1898

Image from page 118 of
Description: Identifier: storyofcolumbus01seel Title: The story of Columbus Year: 1892 (1890s) Authors: Seelye, Elizabeth Eggleston, 1858- Eggleston, Edward, 1837-1902 Subjects: Columbus, Christopher Publisher: New York : D. Appleton and Co. Contributing Library: The Library of Congress Digitizing Sponsor: Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: mbus dared not reprove him,for he had many relatives and friends in the two ships,and Columbus did not want anything to happen to hinderhim from getting back to Spain safely with his good news.Pinzon had really gone off on a voyage of his own. Hehad wasted some time cruising about among small isl-ands, and had tlien gone to Hispaniola and traded forgold along the coast. Half of this gold he kept, andgave the other half to his sailors to persuade them to con-ceal the fact, for the gold belonged to the crown. Thethrifty Pinzon had also captured four Indian men andtwo girls, whom he meant to sell in Spain for slaves. A SKIRMISH. 89 Tlie weather was still rough after the Pinta hadjoined the Nina, so that Columbus was detained sometime longer off the coast of Hispaniola. He saw herewhat he thought to be mermaids, for people at that timebelieved in the existence of these beauties of the sea.But Columbus did not find them so beautiful as theyhad been represented, for the mermaids of Columbus Text Appearing After Image: COLUMBUS FINDS MERMAIDS LESS BEAUTIFUL THAN THEY HAD BEENREPRESENTED TO BE. were probably sea calves. The ships presently came tothe river where Pinzon had been trading. Columbusmade his rebellious captain put ashore the men andgirls that he had captured for slaves, for he did notwish the Indians to have any reason to hate the Span-iards. The ships at length reached the great bay ofSamana, on the western end of the island, and the ad-miral sent some of his men to the land to fill the watercasks for the long voyage, for this was to be the laststopping-place before sailing for Spain. 90 THE STORY OP COLUMBUS. The men were met by a number of Indians armedwith bows and arrows, tipped with fish teeth, and carry-ing heavy wooden swords or clubs with which theycould break a mans skull. They were painted, and re-sembled in all points a party of our North America In-dians on the war-path. They did not fight the whitemen at this time, however, but sold some of their bowsand arrows to the sailor Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 4287
Tags: manatee seacow bookcentury1800 bookdecade1890 booksubjectcolumbuschristopher bookyear1892 bookauthoregglestonedward18371902 bookpublishernewyorkdappletonandco bookidstoryofcolumbus01seel bookauthorseelyeelizabetheggleston1858
1892

Image from page 417 of
Description: Identifier: examplesofhouseh00smit Title: Examples of household taste Year: 1875 (1870s) Authors: Smith, Walter, 1836-1886 Smith, Walter, 1836-1886. Industrial art of the International Exhibition Subjects: Centennial Exhibition (1876 : Philadelphia, Pa.) Decorative arts Publisher: New York, R. Worthington Contributing Library: Sterling and Francine Clark Art Institute Library Digitizing Sponsor: Sterling and Francine Clark Art Institute Library View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: ght handles and rings attached to the upper partof the body. The greater portion of the surface of the vase is enameled ofa light blue color, enriched with exquisitely executed sprays of flowers. Thereis a border of the peculiar key pattern common as well in oriental as in Greekdecoration, and above this a pattern of conventionalized leaf forms. All thedecoration is rich with brilliant colors, picked, here and there, with gold. The beautiful shapes that can be made in glass, as well as the exquisiteenrichment of which it is capable, arc well shown in our illustrations, on page 402 THE INTERNATIONAL EX HIBI T10 N, 18 7 6. 396, of Cut Glass. These examples are from the establishment of M. J. Green,of London, and may be accepted as exemplars of the technical excellence ofthe manufacture in England. Each piece is of blown glass, the nameexpressing the method in which it is shaped, and in this way a brilliancy andclearness of surface is produced which cannot be obtained by any other means. Text Appearing After Image: Ganymede—Terra Gotta: Tke Widow Ipseu of Copenhagen. After the pieces have been thus shaped, the next thing is to cut and engravethe surface as may be required, and we have before us four several examplesin a finished state. The delicacy and perfectness of this work is marvelouswhen we consider that it is all done upon a wheel, and that a slip is irremedi-able. In the goblets the extreme thinness and transparency of the crystalbecomes the more apparent in contrast with the engraving. INDUSTRIAL ART 403 The Embroidered Table-Cover, illustrated on page 397, is an excellentexample of Turkish decorative needle-work. It was one of the numerousexamples of textile manufacture exhibited in the Turkish Court at the Centen- Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 890
Tags: bookdecade1870 bookcentury1800 booksubjectdecorativearts bookpublishernewyorkrworthington bookyear1875 bookauthorsmithwalter18361886 booksubjectcentennialexhibition1876philadelphiapa bookidexamplesofhouseh00smit bookauthorsmithwalter18361886industrialartoftheinternationalexhibition bookcontributorsterlingandfrancineclarkartinstitutelibrary
1875

Image from page 243 of
Description: Identifier: ourcountryinstor00sist Title: Our country in story Year: 1917 (1910s) Authors: Sisters of the Third order of St. Francis of the perpetual adoration. [from old catalog] Subjects: Publisher: Chicago, New York, Scott, Foresman and company Contributing Library: The Library of Congress Digitizing Sponsor: Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: CAPTURE OF THE ENGLISH COMMANDER No one thought of resisting, neither did any one thinkof continuing the dance, but all fled to hide away in thedarkness of their homes dreading what the morningmight bring. For the English had taught their Frenchand Indian subjects to call the Americans Big Knives andto fear them quite as much as the worst of savages. To strengthen the Kaskaskians in this idea and therebyto frighten them into submission, as it were, Clarkstroops, at the signal of three rifle reports, started up suchhideous whooping and scalp-hallooing as might have 238 OUR COUNTRY IN STORY Text Appearing After Image: given credit to the most savage redmen. As the blood-curdling notes echoed and re-echoed from the bluffs be-yond, the poor people shrieked and trembled. The Amer-icans are Big Knives indeed, said they, and we havenothing better than captivity, torture, and death to ex-pect from them. Meanwhile runners were speeding through the streetsof the town ordering the people under pain of death tokeep close within doors. At length thecrowing of the cocks announced thedawn of the new day. The hot Julysun soon beat down upon Kaskaskia.But the quaint little houses with theirsloping roofs and wide porches re-mained darkened, the doors closed,and the garden walks deserted. Thechurch bell tolled forth sad and mourn-ful tones so different from its cheerypeals of the previous evening. While all was thuswrapped in silent dread, a man clad in a flowing blackrobe was seen to hasten quietly along the lifeless streetsin the direction of the fort. His whole bearing bespokedignity, courage, and trials borne f Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 670
Tags: bookcentury1900 bookdecade1910 bookpublisherchicagonewyorkscottforesmanandcompany bookyear1917 bookidourcountryinstor00sist bookauthorsistersofthethirdorderofstfrancisoftheperpetualadorationfromoldcatalog bookcontributorthelibraryofcongress booksponsorsloanfoundation bookleafnumber243 bookcollectionamericana
1917

Image from page 66 of
Description: Identifier: birdsnature161904chic Title: Birds and nature Year: 1900 (1900s) Authors: Subjects: Birds Natural history Publisher: Chicago, Ill. : A.W. Mumford, Publisher Contributing Library: Smithsonian Institution Libraries Digitizing Sponsor: Biodiversity Heritage Library View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: ing to the age. Infact, the young male resembles the fe-male except that it is more brilliant incolor. The female may also have moreor less red in the color of its plumage.One shot at Wheatland, Indiana, in 1881.had the plumage more than one-halfred, the red color being of greater ex-tent, in fact, than on the male, whichwas killed by the same shot! The tintof the red is very peculiar, however, be-ing of dull Chinese orange, instead ofpure rosy vermilion, as in the male. The nest of the Summer Tanager isnot a particularly artistic structure. Itis usually shallow but quite firmly built.The walls are constructed with wirystems of grasses and weeds and linedwith finer stems and tendrils. Sometimesthe walls are so thin that the eggs may beseen through them. The nest is usuallyplaced near the extremity of a branch ofa tree near the edge of the forest, and isgenerally from eight to twenty feet abovethe ground. So frail is the nest that itis usually destroyed by the early fallwinds. HHHHIBiH Text Appearing After Image: 101 SUMMER TANAGER. (Piranga rubra). V2 Life-size. COPYRIGHT 1900, BY A. W. MUMFORD, CHICAGO SOME OF THE WOODS OF THE SOUTHLAND. THE DATE-PALM. The earliest fruit of which we read isthe apple—the forbidden apple—and veryold-time lore hints that it was not theapple of our modern times, but the date-apple with which the wily serpent tempt-ed Mother Eve, who, in turn, temptedher too-willing spouse. However thismay be, we know that the Date Apple—or Date-Palm, as we moderns call it—isone of the very earliest fruits cultivated,having been grown for over four thou-sand years along the Euphrates River. The deserts and many regions in Ara-bia would not be habitable were it not forthe Date-Palm. To say nothing of thefruit itself, it is there almost the only treesuitable for use in the construction ofhouses and other necessary objects. Insome regions, it is only because of thepartial shade of these palms, which pro-tect from the burning sun and scorchingwinds, that other fruits can thri Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 6193
Tags: bookidbirdsnature161904chic bookyear1900 bookdecade1900 bookcentury1900 booksubjectbirds booksubjectnaturalhistory bookpublisherchicagoillawmumfordpublisher bookcontributorsmithsonianinstitutionlibraries booksponsorbiodiversityheritagelibrary bookleafnumber66
1900

Lionel Van Praag and three other motorcycle speedway riders, 9 February 1946
Description: Lionel Van Praag and three other motorcycle speedway riders, 9 February 1946, PIX Magazine negative collection, photographed by Ray Olson, State Library of New South Wales, ON 388/Box 014/Item 029, archival.sl.nsw.gov.au/Details/archive/110587383
Owner: State Library of NSW
Views: 4330
Tags: motocycles speedway lionelvanpraag riders sydney australia leathers bikes helmets 1940s
1946

Corn Palace, exterior, Mitchell, S. D. [South Dakota] (LOC)
Description: Bain News Service,, publisher. Corn Palace, exterior, Mitchell, S. D. [South Dakota] 1908 (date created or published later by Bain) 1 negative : glass ; 5 x 7 in. or smaller. Notes: Forms part of: George Grantham Bain Collection (Library of Congress). Title from data provided by the Bain News Service on the negative. Subjects: Mitchell, South Dakota Format: Glass negatives. Rights Info: No known restrictions on publication. For more information, see George Grantham Bain Collection - Rights and Restrictions Information www.loc.gov/rr/print/res/274_bain.html Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Bain News Service photograph collection (DLC) 2005682517 General information about the George Grantham Bain Collection is available at hdl.loc.gov/loc.pnp/pp.ggbain Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/ggbain.02201 Call Number: LC-B2- 473-3
Owner: The Library of Congress
Views: 11849
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpggbain02201
1908

We could use some identification help!  (LOC)
Description: [Interior view of a store] [1864] 1 photograph : print on card mount ; mount 9 x 18 cm (stereograph format) Notes: Title devised by Library staff Forms part of the Marian S. Carson Collection at the Library of Congress. Subjects: Stores & shops--1860-1870. Interiors--1860-1870. Format: Stereographs--1860-1870. Photographic prints--1860-1870. Rights Info: No known restrictions on publication. Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/stereo.1s08781 Call Number: LOT 13696, no. 34
Owner: The Library of Congress
Views: 4949
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpstereo1s08781
1864

Portrait of a man in checked cardigan, Sydney telephone exchange, August 1946
Description: Portrait of a man in checked cardigan, Sydney telephone exchange, August 1946, ACP Magazines Ltd. photographic archive, State Library of New South Wales, ON 388/Box 022/Item 110 collection.sl.nsw.gov.au/digital/04kgXzAMwxNwB
Owner: State Library of NSW
Views: 10565
Tags: patterns telephone exchange clothing fashion 1940s 1940 war years australia
1945

[City Point], Virginia. General Rufus Ingall's coach dog (LOC)
Description: [City Point], Virginia. General Rufus Ingall's coach dog [1865 Mar.] 1 negative (2 plates) : glass, stereograph, wet collodion. Notes: Caption from negative sleeve: Coach dog. Two plates form left (LC-B811-2589A) and right (LC-B811-2589B) halves of a stereograph pair. Photo shows a Dalmatian dog. Credit line: Civil war photographs, 1861-1865, Library of Congress, Prints and Photographs Division. Forms part of: Civil war photographs, 1861-1865 (Library of Congress). Subjects: United States--History--Civil War, 1861-1865. Format: Stereographs--1860-1870. Glass negatives--1860-1870. Rights Info: No known restrictions on publication. For information, see "Civil war photographs, 1861-1865," www.loc.gov/rr/print/res/120_cwar.html Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Civil war photographs, 1861-1865 (Library of Congress) (DLC) 94837685 General information about Civil war photographs is available at hdl.loc.gov/loc.pnp/pp.cwp Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/cwpb.01994 Call Number: LC-B811- 2589
Owner: The Library of Congress
Views: 20767
Tags: libraryofcongress dc:identifier=httpshdllocgovlocpnpcwpb01994
1865

Eleanor Boardman, blue fancy straw - plain & rigid silk crepe trimming (LOC)
Description: Bain News Service,, publisher. Eleanor Boardman, blue fancy straw - plain & rigid silk crepe trimming [between ca. 1920 and ca. 1925] 1 negative : glass ; 5 x 7 in. or smaller. Notes: Title from data provided by the Bain News Service on the negative. Forms part of: George Grantham Bain Collection (Library of Congress). Format: Glass negatives. Rights Info: No known restrictions on publication. For more information, see George Grantham Bain Collection - Rights and Restrictions Information www.loc.gov/rr/print/res/274_bain.html Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Bain News Service photograph collection (DLC) 2005682517 General information about the George Grantham Bain Collection is available at hdl.loc.gov/loc.pnp/pp.ggbain Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/ggbain.36124 Call Number: LC-B2- 6031-5
Owner: The Library of Congress
Views: 2314
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpggbain36124
1920

LEVIATHAN (LOC)
Description: Bain News Service,, publisher. LEVIATHAN [between ca. 1920 and ca. 1925] 1 negative : glass ; 5 x 7 in. or smaller. Notes: Title from unverified data provided by the Bain News Service on the negatives or caption cards. Forms part of: George Grantham Bain Collection (Library of Congress). Format: Glass negatives. Rights Info: No known restrictions on publication. For more information, see George Grantham Bain Collection - Rights and Restrictions Information www.loc.gov/rr/print/res/274_bain.html Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Bain News Service photograph collection (DLC) 2005682517 General information about the George Grantham Bain Collection is available at hdl.loc.gov/loc.pnp/pp.ggbain Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/ggbain.36078 Call Number: LC-B2- 6025-2
Owner: The Library of Congress
Views: 2017
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpggbain36078 ship oceanliner hamburgamericaline hamburgamerikanischepacketfahrtactiengesellschaft hapag ssvaterland vaterland imperatorclass
1920

Judy Canty, schoolgirl Olympic representative, 27 May 1948
Description: Judy Canty, schoolgirl Olympic representative for the long jump, 27 May 1948, by R. Donaldson, State Library of New South Wales, collection.sl.nsw.gov.au/digital/6N273VdxRoQZx
Owner: State Library of NSW
Views: 5210
Tags: olympics australian london1948 longjump
1948

Male Motorcycle rider on his Rudge racing bike, ca. 1935
Description: Male Motorcycle rider on his Rudge racing bike, No. 45, city street setting, ca. 1935, State Library of New South Wales, ON 388/Box 044/Item 249 archival.sl.nsw.gov.au/Details/archive/110620631
Owner: State Library of NSW
Views: 5957
Tags: motorcycles motorbikes rudge australia 1930s bikes
1935

Linotype machines, Anthony Hordern and Sons department store, c. 1935
Description: Linotype machines, Anthony Hordern and Sons department store, c. 1935, gelatin silver print, from Anthony Hordern and Sons pictorial collection, PXE 1103/Vol. 3/Boxes 1-3 collection.sl.nsw.gov.au/record/9Na6DEWY/J8zyeDKjyXg47
Owner: State Library of NSW
Views: 5759
Tags: linotype printing machines australia sydney publishing anthonyhordenandsons statelibraryofnewsouthwales
1935

Trick cyclist and golfer Banner Forbutt, December 1946
Description: Trick cyclist and golfer Banner Forbutt, December 1946, photographed by Ivan Ives, Pix magazine, State Library of New South Wales, ON 388/Box 014/Item 083 collection.sl.nsw.gov.au/digital/8Zl2vRLAwKWlP
Owner: State Library of NSW
Views: 5110
Tags: golf trock golfers unicycles statelibraryofnewsouthwales
1946

Mario Giordano (LOC)
Description: Bain News Service,, publisher. Mario Giordano [between ca. 1920 and ca. 1925] 1 negative : glass ; 5 x 7 in. or smaller. Notes: Title from unverified data provided by the Bain News Service on the negatives or caption cards. Forms part of: George Grantham Bain Collection (Library of Congress). Format: Glass negatives. Rights Info: No known restrictions on publication. For more information, see George Grantham Bain Collection - Rights and Restrictions Information www.loc.gov/rr/print/res/274_bain.html Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Bain News Service photograph collection (DLC) 2005682517 General information about the George Grantham Bain Collection is available at hdl.loc.gov/loc.pnp/pp.ggbain Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/ggbain.35912 Call Number: LC-B2- 5992-5
Owner: The Library of Congress
Views: 3680
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpggbain35912 1923
1920

Exit 2, Sir Goony Golf, Chattanooga, Tennessee (LOC)
Description: Margolies, John,, photographer. Exit 2, Sir Goony Golf, Chattanooga, Tennessee 1986. 1 photograph : color transparency ; 35 mm (slide format). Notes: Title, date and keywords based on information provided by the photographer. Purchase; John Margolies 2010 (DLC/PP-2010:191). Credit line: John Margolies Roadside America photograph archive (1972-2008), Library of Congress, Prints and Photographs Division. Please use digital image: original slide is kept in cold storage for preservation. Forms part of: John Margolies Roadside America photograph archive (1972-2008). Subjects: Miniature golf--1980-1990. United States--Tennessee--Chattanooga. Format: Slides--1980-1990.--Color Rights Info: No known restrictions on publication. For more information, see "John Margolies Roadside America Photograph Archive - Rights and Restrictions Information" www.loc.gov/rr/print/res/723_marg.html Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Margolies, John John Margolies Roadside America photograph archive (DLC) 2010650110 General information about the John Margolies Roadside America photograph archive is available at hdl.loc.gov/loc.pnp/pp.mrg Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/mrg.02762 Call Number: LC-MA05- 2762
Owner: The Library of Congress
Views: 3538
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpmrg02762
1986

Is that a
Description: The Clonbrocks were out foreign again and took this interesting image while there. At first sight I thought the train was a case of a "Pushme Pullyou" as described in Dr. Doolittle but I was mistaken. The catalogue title makes note of the pump to the right and there is just so much to see in this lovely shot. Wouldn't it be lovely to see it colourised? Photographers: Dillon Family Contributors: Luke Gerald Dillon, Augusta Caroline Dillon Collection: Clonbrock Photographic Collection Date: 7 August 1901 NLI Ref: CLON682 You can also view this image, and many thousands of others, on the NLI’s catalogue at catalogue.nli.ie
Owner: National Library of Ireland on The Commons
Views: 6185
Tags: theclonbrockphotographiccollection lukegeralddillon baronclonbrock augustacarolinedillon baronessclonbrock dillonfamily nationallibraryofireland europe familytrip chalets
1901

The Rocks at the top of the hill.
Description: A gentleman in Tweed jacket and breeches admires a Dolmen or Cromlech at the top of a very stony hill. This image from the Clonbrock Collection has a date, but no location. Somehow rural scenes in those days seemed more rugged with rocks more exposed, and I suspect that this scene is more overgrown today? Photographers: Dillon Family Contributors: Luke Gerald Dillon, Augusta Caroline Dillon Collection: Clonbrock Photographic Collection Date: Tuesday, 10 May 1881 NLI Ref: CLON359 You can also view this image, and many thousands of others, on the NLI’s catalogue at catalogue.nli.ie
Owner: National Library of Ireland on The Commons
Views: 6337
Tags: theclonbrockphotographiccollection lukegeralddillon baronclonbrock augustacarolinedillon baronessclonbrock dillonfamily nationallibraryofireland dolmen cromlech rockyhillside
1881

Description: Kimball, M. H.,, active 1863-1865,, photographer. "Rebecca, Charley, and Rosa, slave children from New Orleans" [New York] : [Kimball, 477 Broadway], [1863] 1 photograph : albumen print on card mount ; mount 10 x 7 cm (carte de visite format) Notes: Photograph shows freed slaves Rebecca Huger, Charles Taylor, and Rosina Downs standing together. Title from item. Printed on verso: "The nett [sic] proceeds from the sale of these photographs will be devoted exclusively to the education of colored people in the Department of the Gulf, now under the command of Maj.-Gen. Banks." Gift; Tom Liljenquist; 2016; (DLC/PP-2016:144) Purchased from: Greg French, Early Photography, Jamaica Plain, Massachusetts, July 2015. Forms part of: Liljenquist Family Collection of Civil War Photographs (Library of Congress). Subjects: African Americans--Children--1860-1870. Girls--1860-1870. Boys--1860-1870. Freedmen--1860-1870. United States--History--Civil War, 1861-1865--Children. Format: Portrait photographs--1860-1870. Cartes de visite--1860-1870. Albumen prints--1860-1870. Rights Info: No known restrictions on publication. Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Liljenquist Family collection (Library of Congress) (DLC) 2010650519 Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/ppmsca.40173 Call Number: LOT 14043-2, no. 71
Owner: The Library of Congress
Views: 4652
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpppmsca40173 rebeccahuger charlestaylor rosinadowns
1863

Description: Kimball, M. H.,, active 1863-1865,, photographer. "Rebecca, a slave girl from New Orleans" [New York] : [Kimball, 477 Broadway], [1863] 1 photograph : albumen print on card mount ; mount 10 x 7 cm (carte de visite format) Notes: Photograph shows freed slave Rebecca Huger. Title from item. Printed on verso: "The nett [sic] proceeds from the sale of these photographs will be devoted exclusively to the education of colored people in the Department of the Gulf, now under the command of Maj.-Gen. Banks." Tax stamp on verso. DLC Gift; Tom Liljenquist; 2016; (DLC/PP-2016:144) Forms part of: Liljenquist Family Collection of Civil War Photographs (Library of Congress). Subjects: African Americans--Children--1860-1870. Girls--1860-1870. Freedmen--1860-1870. United States--History--Civil War, 1861-1865--Children. Format: Portrait photographs--1860-1870. Cartes de visite--1860-1870. Albumen prints--1860-1870. Rights Info: No known restrictions on publication. Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Liljenquist Family collection (Library of Congress) (DLC) 2010650519 Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/ppmsca.40567 Call Number: LOT 14043-2, no. 103
Owner: The Library of Congress
Views: 14115
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpppmsca40567 rebeccahuger
1863

Understated elegance from Plumstead
Description: For a Monday morning with the lockdowns easing it is nice to celebrate, and what better way to do so than with a small wedding image. Some people, even though they have been posed, have a natural elegance, and the couple in this shot have just that. Commissioned by Mr. Holohan of Plumstead in London, this may not be that easy to add information to? Or will it? Photographer: Poole Studio Photographer Collection: Poole Photographic Collection, Waterford Date: ca. 1901-1954 Around Monday, 6 June 1938. NLI Ref: POOLEWP 4261 You can also view this image, and many thousands of others, on the NLI’s catalogue at catalogue.nli.ie
Owner: National Library of Ireland on The Commons
Views: 7724
Tags: ahpoole arthurhenripoole poolecollection glassnegative nationallibraryofireland weddingday plumstead london scroope houlihan
1938

I’m Bert, p’raps you’ve heard of me?
Description: W.J. Brennan of Market Street, Tramore may have been the dedicated follower of fashion in 1905, but in 2021 he seems the perfect caricature of “Burlington Bertie from Bow”! We know the date, the name, the place. So what more can we find out about W.J. “Bertie” Brennan? Photographer: A. H. Poole Collection: Poole Photographic Collection, Waterford Date: Saturday, 8 July 1905 NLI Ref: POOLEWP 1476a You can also view this image, and many thousands of others, on the NLI’s catalogue at catalogue.nli.ie
Owner: National Library of Ireland on The Commons
Views: 8251
Tags: ahpoole arthurhenripoole glassnegative nationallibraryofireland wjbrennan marketstreet tramore boaterhat walkingstick poolephotographiccollection
1905

Dulcie Deamer, 1 April 1950
Description: Dulcie Deamer at her writing desk, novelist, poet, journalist, actor and founder and committee member of the Fellowship of Australian Writers, 1 April 1950, photographed for People magazine, from original negative, ON 388/Box 066/Item 026 digital.sl.nsw.gov.au/delivery/DeliveryManagerServlet?emb...
Owner: State Library of NSW
Views: 22069
Tags: dulciedeamer australian writers novelists actors poets journalists 1050s female women
1950

Glassblowers at work, Crown Crystal Studio, Sydney, 1950
Description: Glassblowers at work, Crown Crystal Studio, Waterloo, Sydney, 1950, from vintage print, for Walkabout magazine, State Library of New South Wales, PXA 907 Box 11 archival.sl.nsw.gov.au/Details/archive/110312015
Owner: State Library of NSW
Views: 6777
Tags: commercial businesses sydney waterloo crownstudio glassblowing glass manufacturers
1950

Where is this? (LOC)
Description: [Trail with view of the water through the trees] [1864] 1 photograph : print on card mount ; mount 9 x 18 cm (stereograph format) Notes: Title devised by Library staff Forms part of the Marian S. Carson Collection at the Library of Congress. Subjects: Trees--1860-1870. Trails & paths--1860-1870. Format: Stereographs--1860-1870. Photographic prints--1860-1870. Rights Info: No known restrictions on publication. Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/stereo.1s08768 Call Number: LOT 13696, no. 19
Owner: The Library of Congress
Views: 8009
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpstereo1s08768
1864

Identified! [Bathing houses at Downer Landing (or Downer's Landing), Boston, Massachusetts] (LOC)
Description: [Bathing houses at Downer Landing (or Downer's Landing), Boston, Massachusetts] [between 1860 and 1890] 1 photograph : print on card mount ; mount 9 x 18 cm (stereograph format) Notes: Series on mount: Marine Views. Stereoscopic Studies. Title from item. Forms part of the Marian S. Carson Collection at the Library of Congress. Subjects: Recreation--1860-1890. Format: Stereographs--1860-1890. Photographic prints--1860-1890. Rights Info: No known restrictions on publication. Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/stereo.1s08754 Call Number: LOT 13696, no. 4
Owner: The Library of Congress
Views: 3602
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpstereo1s08754 bathinghouses downerlanding downerslanding bostonmassachusetts boston massachusetts hinghammassachusetts hingham
1860

The Smyths?
Description: Our catalogue tells us that this lovely family group was commissioned by Mrs. Smyth, 44 Poleberry, Waterford, which should help you with your deliberations. I always look forward to reading the comments on a photo like this one. It is fantastic that you can discover so much information about the people in the photos we feature here on Flickr, it really does bring them alive. +++ UPDATE +++ Well, this family photograph led to a lively chase up and down Poleberry in Waterford, trying to match likely families, and likely dogs in online dog license records. But the main problem is the “unusual” house numbering of Poleberry. Our Bernard Healy is not usually given to cast asparagus at anyone, but even he was driven to this extreme: “I think we have to conclude that the census enumerator was drunk, or the houses were re-numbered at some stage”. Photographer: A. H. Poole Collection: Poole Photographic Collection, Waterford Date: 6 September 1919 NLI Ref: POOLEWP 2819 You can also view this image, and many thousands of others, on the NLI’s catalogue at catalogue.nli.ie
Owner: National Library of Ireland on The Commons
Views: 8159
Tags: ahpoole arthurhenripoole glassnegative nationallibraryofireland mrssmyth 44poleberry waterford munster dog poolephotographiccollection
1919

Midnight sun, over the Ross Sea, Antarctic, December 1910
Description: Midnight sun, over the Ross Sea, Antarctic, December 1910, photograph album of the Scott expedition to Antarctica, 1910-1913, annotated by T. Griffith Taylor, vintage gelatin-silver print, State Library of New South Wales, search.sl.nsw.gov.au/permalink/f/1cvjue2/ADLIB110339803
Owner: State Library of NSW
Views: 6904
Tags: antarctic antarctica rosssea robertfalconscott scott griffith taylorgeologyexpeditionsterra nova expeditionstate library
1910

Lady J. Hamilton (LOC)
Description: Bain News Service,, publisher. Lady J. Hamilton [between ca. 1920 and ca. 1925] 1 negative : glass ; 5 x 7 in. or smaller. Notes: Title from unverified data provided by the Bain News Service on the negatives or caption cards. Forms part of: George Grantham Bain Collection (Library of Congress). Format: Glass negatives. Rights Info: No known restrictions on publication. For more information, see George Grantham Bain Collection - Rights and Restrictions Information www.loc.gov/rr/print/res/274_bain.html Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Bain News Service photograph collection (DLC) 2005682517 General information about the George Grantham Bain Collection is available at hdl.loc.gov/loc.pnp/pp.ggbain Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/ggbain.35606 Call Number: LC-B2- 5944-2
Owner: The Library of Congress
Views: 7881
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpggbain35606 ladyjeanhamilton 1922 jeandouglashamilton dog terrier
1920

Happy Hatoriffic(ish) weekend to you all.
Description: A group of three, two ladies with fine hats on board. And a gentleman sitting down while the ladies stand? Miss Nolan of Brownswood, Carrick-on-Suir was the lady who made the commission, but is she in the image, and what was the occasion? +++ UPDATE +++ Looks as if this one will have to simmer on the back burner for a while. No Brownswood Nolans in either the 1901 or 1911 censuseses. And Evening Mary could find nothing in any online newspapers. We shall sit back (if we can get a chance to sit down with these young feller-me-lads hogging all the seating) and await developments... Photographer: A. H. Poole Collection: Poole Photographic Collection, Waterford Date: ca. Wednesday, 16 October 1907 NLI Ref: POOLEWP 1717a You can also view this image, and many thousands of others, on the NLI’s catalogue at catalogue.nli.ie
Owner: National Library of Ireland on The Commons
Views: 8965
Tags: ahpoole arthurhenripoole glassnegative nationallibraryofireland missnolan brownswood carrickonsuir countytipperary munster hats
1907

Rosaleen Norton, Kings Cross, Sydney, 21 June 1943
Description: Rosaleen Norton, Kings Cross, Sydney, 21 June 1943, by Ivan, for PIX Magazine, from photographic negative, State Library of New South Wales, ON 388/Box 020/Item 059 archival.sl.nsw.gov.au/Details/archive/110591896 A New Zealand-born Australian artist and occultist who lived much of her later life in the bohemian area of Kings Cross, Sydney, leading her to be termed the "Witch of Kings Cross." en.wikipedia.org/wiki/Rosaleen_Norton
Owner: State Library of NSW
Views: 8114
Tags: rosaleennorton witchcraft witches sydney kingscross australia australiainthe1940s
1943

Dr. Roque Saenz Pena, Pres't Argentina (LOC)
Description: Bain News Service,, publisher. Dr. Roque Saenz Pena, Pres't Argentina [between ca. 1920 and ca. 1925] 1 negative : glass ; 5 x 7 in. or smaller. Notes: Title from data provided by the Bain News Service on the negative. Forms part of: George Grantham Bain Collection (Library of Congress). Format: Glass negatives. Rights Info: No known restrictions on publication. For more information, see George Grantham Bain Collection - Rights and Restrictions Information www.loc.gov/rr/print/res/274_bain.html Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Bain News Service photograph collection (DLC) 2005682517 General information about the George Grantham Bain Collection is available at hdl.loc.gov/loc.pnp/pp.ggbain Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/ggbain.35571 Call Number: LC-B2- 5932-16
Owner: The Library of Congress
Views: 6439
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpggbain35571
1920

Image from page 228 of
Description: Identifier: billederafnorden01ment Title: Billeder af nordens flora Year: 1917 (1910s) Authors: Mentz, August, 1867-1944 Ostenfeld, C. H. (Carl Hansen), 1873-1931 Subjects: Plants Plants Plants Publisher: København, G.E.C. Gad's forlag Contributing Library: The LuEsther T Mertz Library, the New York Botanical Garden Digitizing Sponsor: The LuEsther T Mertz Library, the New York Botanical Garden View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: GÆRDE-SNERLE, convolvulus sepiui LBORTZEliS Ttt A. B STHti^ 106 Text Appearing After Image: HUMLE-SILKE, cuscuta europæa. 107 Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 601
Tags: bookcentury1900 booksubjectplants bookdecade1910 bookyear1917 bookidbillederafnorden01ment bookauthormentzaugust18671944 bookauthorostenfeldchcarlhansen18731931 bookpublisherkbenhavngecgadsforlag bookcollectionbiodiversity bookcollectionnybotanicalgarden
1917

Image from page 145 of
Description: Identifier: internationalstu75newy Title: International studio Year: 1897 (1890s) Authors: Subjects: Art Decoration and ornament Publisher: New York Contributing Library: Robarts - University of Toronto Digitizing Sponsor: University of Toronto View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: family, theirname being an old one) andthen a long period of romanticwandering in the circle of his own province, withoccasional trips to Paris and a vacation in Brit-tany. He does not talk much about his paintings—not at all of the success he has had. His attitudeis natural to a man whose world is as large as allout-doors—and as small as Auvergne. Withoutputting it into obvious words he must believe thattrees, hillsides, farms and lively colors exist alongwith other beautiful things for their own sakes.Not like Renoir, whose eyes -aw life in terms otpaint, he is one to whom life means country air, sincere and self-evident artist if ever there were peasant hardship and all kinds ol frien . well one. His life has not been extraordinary; now at as landscapes. He is a wiry I middle age he can look back on a mild but promis- an energetic out-door life. ing career as a lawyer, a moment of great excite- But let me stop to emphasize Char APRIL I922 one hundred nine inceRHAcioriAL stroa© Text Appearing After Image: RAYS OF AUTUMN-BY VICTOR sincerity and erase any wrongimpression I may have given.To him praise is a by-product of his own praise fora beautiful part of France. He does not look forhonors any more than did Monet and he doesnot use the position they give him to seek for anyother kind of success. When one realizes thatCharreton is partly poet and romanticist and thathe is not out of sympathy with artistic develop-ments other than his own, it is easy to explain thereason for these official gifts of praise. His work,sent to Paris at the suggestion of a friend, had anauspicious start, for it appeared either amongimitative, traditional work or in comparison withthe austerity of the more advanced manner.Academicians turned readily to honor the beauti-ful as they discovered it in Charretons love forcolor. In the minds of the Beaux-Arts officials herepresents the true tradition that has come out ofthe great Impressionists, and has nothing to dowith other traditions which have sprung up inhalf Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 689
Tags: booksubjectart booksubjectdecorationandornament bookcentury1800 bookdecade1890 bookpublishernewyork bookyear1897 bookidinternationalstu75newy bookleafnumber145 bookcontributorrobartsuniversityoftoronto booksponsoruniversityoftoronto
1897

Image from page 80 of
Description: Identifier: gliantichisepolc00bart_0 Title: Gli antichi sepolcri, ovvero, Mausolei romani ed etruschi trovati in Roma ed in altri luoghi celebri : nelli quali si contengono molte erudite memorie Year: 1767 (1760s) Authors: Bartoli, Pietro Santi, 1635-1700 Bonfigli, Marco Antonio Pietro, da Cortona, 1596-1669 Calcografia camerale (Rome, Italy) Subjects: Sepulchral monuments Tombs Sculpture, Roman Sculpture, Etruscan Inscriptions, Latin Publisher: In Roma : [Calcografia della Rev. Camera Apostolica] Contributing Library: Getty Research Institute Digitizing Sponsor: Getty Research Institute View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: Si quadrata comparto cUpieira.Tù7urtinaJIiìscriatoné desso fa conoscere che appartiene à Caio Vooliaalklìlk aeuaplebeacuiilS-eFRj^ cheSob all Iinperadori> etalit Vestili si convenuta, hautndqc/li permesso dentro la City illuqjioper riporui ledihiCtnerie d suoi pastori contro la leifataeUe^ilITauole.conu lo rferif ce Cicer; Ouidio ne^asti/a nuntione diduejratelk J?ubhcyX.dià delia Plebe che ordinarono Ejiuochijlorali Pianta di antico Sepolcro nella Via Appi a, incontro Domine quo uadisCreduto communemente dellafa/mplia de Scipio/li: La pianta fatta dipunti dimostra Uprimo ordine a pian terreno, laltra circolare u disopra,. Text Appearing After Image: Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 892
Tags: booksubjectsculptureroman booksubjectsepulchralmonuments bookauthorbartolipietrosanti16351700 bookauthorpietrodacortona15961669 booksubjectinscriptionslatin booksubjecttombs bookidgliantichisepolc00bart0 bookauthorbonfiglimarcoantonio bookauthorcalcografiacameraleromeitaly booksubjectsculptureetruscan
1825

Image from page 261 of
Description: Identifier: textbookofpasto00hars Title: Textbook of pastoral and agricultural botany, for the study of the injurious and useful plants of country and farm Year: 1920 (1920s) Authors: Harshberger, John W. (John William), 1869-1929 Subjects: Botany, Economic Poisonous plants Publisher: Philadelphia : P. Blakiston's Son & Co. Contributing Library: University of British Columbia Library Digitizing Sponsor: University of British Columbia Library View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: klebur (Xanthium), rag weed (Ambrosia arlemisicefoUa),vervain {Verbena Jiastata, V. urticifolla), horse nettle {Solanum carolinense)and others. Of late and in consequence of increased communicationwith the prairies and the country beyond the Mississippi River, the west-^ern plants are moving eastward by rapid strides. Such are fetid mari- 244 PASTORAL AND AGRICULTURAL BOTANY gold {Dyssodia papposa), pineapple weed (Matricaria suaveolens) andwormwood (Artemisia biennis). Ninety years ago the black-eyed susan(Rudbeckia hirta) flourished from the Alleghany mountains westward,but was unknown in the east. Now since about i860, it has become anabundant and conspicuous weed in grass fields throughout the easternstates, as far as the Gulf of St. Lawrence, having been accidentally intro-duced in red clover seeds from the western states. The velvet leaf (Abu-iilon llieophrasti) and princes feather (Polygonum orientate) have beenintroduced from India. The bur clover came to California from South Text Appearing After Image: Fig. 100.- -Russian thistle {.^(lisn kuU var. icnuijolia) asa tunibleweed at Akron, Colorado.(G. E. Nichols, 1913.) America. The orange hawk weed (Hieracium aurantiactim) was grownfron! imported European seed by the aunt of the botanist, Cyrus G Pringle,in Charlotte, Vermont about 1845. The plant was much admired and sentto friends in Maine, Massachusetts and Vermont, according to Prof. Geo.P. Burns. It was cultivated in some gardens of Maine under the nameof tassel-flower, or Venuss paint-brush. It propagates very freely byrunners, as well, as by feathery fruits. It is now spread over large areasof Maine and other New England states, in northern Pennsylvania, asat Eaglesmere, where a field of it was noted by the writer in full bloomon June 22, 1905. WEEDS AND WEED CONTROL 245 Means of Distribution.—When once introduced, weeds migrate ina number of ways by natural and artificial means. The natural migra-tion of weeds is favored by the possession of runners (slender radiatingbranches Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 5344
Tags: bookdecade1920 bookcentury1900 booksubjectpoisonousplants bookyear1920 booksubjectbotanyeconomic bookidtextbookofpasto00hars bookauthorharshbergerjohnwjohnwilliam18691929 bookpublisherphiladelphiapblakistonssonco bookleafnumber261 bookcontributoruniversityofbritishcolumbialibrary
1920

Image from page 122 of
Description: Identifier: surgicalobstetri02will Title: Surgical and obstetrical operations Year: 1907 (1900s) Authors: Williams, W. L. (Walter Long), 1856-1945 Pfeiffer, Wilhelm, 1870- Subjects: Veterinary surgery Publisher: Ithaca, N. Y., The author Contributing Library: The Library of Congress Digitizing Sponsor: Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: Text Appearing After Image: AMPUTATION OF THE PENIS. 107 interrupted sutures as shown in Fig. II, Plate XVII in sucha manner that they pass through the urethral wall and theskin so that when tied the wounded surfaces are completelyhidden and the urethral mucous membrane is brought intoapposition with the integument. Continue these suturesdown to the base of the triangle after which remove the Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 603
Tags: bookcentury1900 bookdecade1900 booksubjectveterinarysurgery bookyear1907 bookidsurgicalobstetri02will bookauthorwilliamswlwalterlong18561945 bookauthorpfeifferwilhelm1870 bookpublisherithacanytheauthor bookcontributorthelibraryofcongress booksponsorsloanfoundation
1907

Image from page 162 of
Description: Identifier: napoleonkingmura00espi Title: Napoleon and King Murat, a biography compiled from hitherto unknown and unpublished documents Year: 1912 (1910s) Authors: Espitalier, Albert, b. 1874 May, James Lewis, 1893- Subjects: Napoleon I, Emperor of the French, 1769-1821 Joachim Murat, King of Naples, 1767-1815 Naples (Kingdom) -- History Publisher: London : John Lane New York, John Lane Company View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: that his sojourn in Paris was to be merely tem-porary. He therefore accepted with pleasure the Em-perors invitation of the 15th May asking him toRambouillet, whither he set out that very same day.^It is possible indeed that he would have still furtherprolonged his stay, had he not received on the i8thdispatches from Agar, Zurlo and Maghella, couched insuch panic-stricken language that he decided to makerequest to the Emperor for permission to depart im-mediately. My departure, he said, cannot interfere withyour plans, while it may restore confidence among mypeople. 2 Napoleon, who had no longer any reason forrefusing his permission, gave a most favourable recep-tion to Joachims request. Not only did he grant himleave to depart, but even told Bassano to censure Durant,his newly appointed Minister at Naples, though thelatters sole fault throughout the whole business had Campochiaro to Gallo, May l6, i8il. Naples, Archivio di Stato.^ Murat to Napoleon, May 19, 1811. Affaires Etrangeres. Text Appearing After Image: THE DUKK OK REKHSIADT (NAIOI.EON II) l-roiii a pain till:;, probally /•} Daffinger. In tlu possession of /?. Ai<i;ust Ileyiiinnn of Iir/iiui THE RISE OF THE NATIONALISTS 133 been to read the situation too clearly. The 20th May,the day preceding the Emperor and Empresss departurefor Cherbourg and Rochefort, he spent with them atRambouillet. After bidding farewell to Napoleon hereturned to Paris at night, and on the 22nd May, as soonas it was light, commenced his journey to Naples. Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 6062
Tags: bookcentury1900 bookyear1912 bookdecade1910 bookpublisherlondonjohnlane booksubjectnapoleoniemperorofthefrench17691821 bookpublishernewyorkjohnlanecompany booksubjectjoachimmuratkingofnaples17671815 bookidnapoleonkingmura00espi bookauthorespitalieralbertb1874 bookauthormayjameslewis1893
1912

Image from page 81 of
Description: Identifier: hwbuckbeeseedpla1905hwbu Title: H.W. Buckbee seed and plant guide : 1905 Year: 1905 (1900s) Authors: H.W. Buckbee (Firm) H.W. Buckbee (Firm) Henry G. Gilbert Nursery and Seed Trade Catalog Collection Subjects: Seeds Illinois Rockford Catalogs Vegetables Illinois Rockford Catalogs Flowers Illinois Rockford Catalogs Plants, Ornamental Illinois Rockford Catalogs Roses Illinois Rockford Catalogs Bulbs (Plants) Illinois Rockford Catalogs Lawns Seeds Illinois Rockford Catalogs Publisher: Rockford, Ill. : Buckbee Contributing Library: U.S. Department of Agriculture, National Agricultural Library Digitizing Sponsor: U.S. Department of Agriculture, National Agricultural Library View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: HAMMONDS SLUG SHOT. Guaranteed to destroy Potato Bugs and those on Toma-toes and Egg Plants, Currant Worms, cabbage Lice andWorms, Fleas, Beetles and Striped Bugs on Melons,turnips. Beets, Onions, etc. Also a preventative of theRose Bug and Cut Worm. Use In the morning while thedew is on. Postpaid, lb. 15c. Freight or express, atbuyers expense, 5 lbs. 30c; 10 lbs. 50c; 25 lbs. $1.25;60 lbs. $2.25; 100 lbs. $4.25; 1,000 lbs. $40.00. LANGS HAND WEEDEO riANDIEsv J00L//(3^ Dearth; 25c. BrM/jiLPrepaid YOU BUY YOUR SEEDS FROM THE GROWER WHEN YOU BUY FROM BUCKBEE. 76 H. W. BUCKBEE. ROCKFORO, ILLINOIS. BlICKBEEjl HAM PI ON Text Appearing After Image: Among Carrots TryThisCarrot. Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 444
Tags: bookcentury1900 bookdecade1900 bookauthorhenryggilbertnurseryandseedtradecatalogcollection bookauthorhwbuckbeefirm booksubjectseedsillinoisrockfordcatalogs booksubjectvegetablesillinoisrockfordcatalogs booksubjectflowersillinoisrockfordcatalogs booksubjectplantsornamentalillinoisrockfordcatalogs booksubjectrosesillinoisrockfordcatalogs booksubjectbulbsplantsillinoisrockfordcatalogs
1905

Image from page 52 of
Description: Identifier: walksinlondon02hare Title: Walks in London Year: 1901 (1900s) Authors: Hare, Augustus J. C. (Augustus John Cuthbert), 1834-1903 Subjects: London (England) -- Description and travel Publisher: London : G. Allen Contributing Library: University of California Libraries Digitizing Sponsor: MSN View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: —We rise bynine, and those that frequent great mens levees find entertainment at them tilleleven, or, as at Holland, go to tea-tables. About twelve, the beau-rrwndeassembles in several coffee or chocolate houses ; the best of which are the CocoaTree, and Whites chocolate-houses; St. Jamess, the Smyrna, Mr. Rochfords,and the British coffee-houses; and all these so near one another, that in lessthan one hour you see the company of them all. We are carried to these places 1 The genial wit, of whom Curran said. Die when you will, Charles, you willdie in your youth. 2 Pepys, Jan. 14, 1667-68. 3 Feb. 15, 1668-69. 4 Built 1681. Called after Sir Philip Warn ick 5 Lord Brougham. Haymarket 41 in Sedan chairs, which are here very cheap, a guinea a week, or a shilling perhour; and your chairmen serve you for porters to run on errands, as yourgondoliers do at Venice. Passing the equestrian statue of George III., by Wyatt, 1837, wenow reach the foot of the Haymarket, so called from the market for Text Appearing After Image: THE DUKE OF YORK S COLUMN. hay and straw which was held here in the reign of Elizabeth, and wasnot finally abolished till 1830. On the right is the Haymarket Theatre,designed by Nash; on the left Her Majestys (built in 1790, burntDecember 1867, reopened 1877, pulled down 1893, and rebuilt by W.Emderi). It was between these, at the foot of the Haymarket, thatThomas Thynne of Longleat was murdered on Sunday, Feb. 12, 1682,by ruffians hired by Count Konigsmarck, who hoped, when Thynne wasout of the way, to ingratiate himself with his affianced bride, the rich 42 Walks in London young Lady Elizabeth Percy, already, in her sixteenth year, the widowof Lord Ogle. The assassins employed were Vratz, a German ; Stern,a Swede ; and Borotski, a Pole ; but only the last of these fired, thoughno less than five of his bullets pierced his victim. The scene is repre-sented on Thynnes monument in Westminster Abbey. The con-spirators were taken, and tried at Hickss Hall in Clerkenwell, whereKonigsmarck Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 1693
Tags: bookcentury1900 bookyear1901 bookdecade1900 bookpublisherlondongallen bookauthorhareaugustusjcaugustusjohncuthbert18341903 bookidwalksinlondon02hare booksubjectlondonenglanddescriptionandtravel bookcollectionamericana bookleafnumber52 bookcontributoruniversityofcalifornialibraries
1901

Image from page 130 of
Description: Identifier: capecodoldcolony1921brig Title: Cape Cod and the Old colony Year: 1921 (1920s) Authors: Brigham, Albert Perry, 1855-1932 Subjects: Pilgrims (New Plymouth Colony) Cape Cod (Mass.) Publisher: New York and London, G.P. Putnam's Sons Contributing Library: University of Connecticut Libraries Digitizing Sponsor: University of Connecticut Libraries View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: aharan oases, on the shores of France, Britainor the Low Countries, on the banks of theColimibia River, and, for at least two hundredyears, in the outer parts of Cape Cod. On the French coast and elsewhere, stakeand brush fences are carried along the crest ofa dune, that the sands may lodge in andbeyond them. When the fence is engulfed an-other is erected above it, until after sufficientupward building, the winds fail to carry thesand over and a barrier dune has come intobeing which protects the inland fields frominvasion. This method has never been used on theCape, where the more widespread method pre-vails of supplementing natures protectiveefforts, by preserving natural vegetation andby artificial plantings of grasses and trees.Readers of Thoreau recall his playful imag-inings about tying up the Cape to its moor-ings, and they remember his references to thewarning-out of the townsmen in the spring toplant beach grass in exposed situations. Fewer than the readers of Thoreaus classic Text Appearing After Image: 4 M The Changing Shoreline 93 sketches are those who know that one of theobjects of the agricultural explorers sent outall over the world from Washington has beento find sand-binding grasses, which wouldavail to hold dunes in place for the salvationof harbors and cultivated lands. The dangersof sand shifting have long been recognized onCape Cod and the great fear was that the sandsmight invade the harbor of Provincetown andthus destroy one of the most importanthavens on the New England coast. The force of the winter storms is little real-ized by the summer inhabitants. A singlestorm may dash the sands so effectively onwindows close to the shore that their trans-parency is destroyed. At the Highland LifeSaving Station, the life guards say that theyhave covered a pane of glass with a stencil,and have seen letters well etched in a stormblowing for three hours. Sand grains as largeas grains of wheat have been freely swept upfrom the beaches and deposited on the dunes,wind velocities of fi Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 2030
Tags: bookdecade1920 bookcentury1900 booksubjectpilgrimsnewplymouthcolony bookyear1921 bookpublishernewyorkandlondongpputnamssons bookauthorbrighamalbertperry18551932 bookidcapecodoldcolony1921brig booksubjectcapecodmass bookcollectionamericana bookcollectionblc
1921

Image from page 44 of
Description: Identifier: diseasesofnose00knig Title: Diseases of the nose and throat Year: 1903 (1900s) Authors: Knight, Charles H. (Charles Huntoon), b. 1849 Subjects: Nose Throat Publisher: Philadelphia, P. Blakiston's son & co. Contributing Library: The Library of Congress Digitizing Sponsor: The Library of Congress View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: application of cocaine, two per cent,to the inflamed nares, followed by an insufflation of Ferriers snuff(morph. sulph. gr. i, bismuth, subnitr. oiii, pulv. acacia oi) is verysoothing and will contribute to the comfort of the patient (Fig. 15).Cocaine should never be entrusted to a patient except in extremecases and unless we are quite sure of his capacitv to resist the fasci- ACUTE RHINITIS. 39 nations of the habit. The question of the local effect, damaging orOtherwise, of repeated and prolonged use of cocaine is still undeter-mined. The abuse of an agent, so energetic and decided in its action,may do permanent harm. There is no doubt about the comfort itgives by emptying the venous sinuses and thus restoring the caliberof the nostrils. But its effects are transitory, and the temptation toresort to it again and again is almost irresistible. The promiscuousrecommendation of cocaine is, therefore, dangerous and should bediscountenanced. A solution of cocaine alkaloid, two per cent, in Text Appearing After Image: equal parts of almond and petroleum oil has been found by WyattWingrave to give more prolonged results though acting somewhatmore slowly than a watery solution. A five per cent, watery solutionof cocaine hydrochloratc, containing two per cent, sodium sulphate,proved to give as complete effects as much stronger solutions ofcocaine alone. Thus the danger of toxic symptoms is much reducedand moreover the combination is more rapid in its action. Theinhalation of a vapor of camphor and menthol (5 grs. of each to oneounce of fluid albolene or benzoinated albolene) will usually givetemporary relief and may be safely repeated at short intervals. The 40 DISEASES OF THE NOSE AND THROAT. patient may be instructed to inhale from a wide-mouthed bottle con-taining equal parts of powdered camphor and menthol to which a fewdrops of ammonia have been added. The famous Hager-Brandremedy (acid, carbol. 5i, alcohol oiii, aq. amnion, fort, oi, aq. distill,oii) may be used in a similar way, or may be sprin Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 642
Tags: bookcentury1900 bookdecade1900 booksubjectnose bookyear1903 bookiddiseasesofnose00knig bookauthorknightcharleshcharleshuntoonb1849 booksubjectthroat bookpublisherphiladelphiapblakistonssonco bookcontributorthelibraryofcongress bookcollectionamericana
1903

Image from page 42 of
Description: Identifier: delatransfusiond00cass Title: De la transfusion du sang Year: 1874 (1870s) Authors: Casse, Joseph Subjects: Blood Blood Transfusion Publisher: Bruxelles : Henri Manceaux Contributing Library: Francis A. Countway Library of Medicine Digitizing Sponsor: Open Knowledge Commons and Harvard Medical School View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: empérature = 39,7. Pouls 64 un peuirrégulier et respiraiion plus calme. Tracé graphique des variations de la température pendant la 6™« expérience. 39.6-— Septième expérience. — 13 juillet. Le chien pèse 13,200 grammes. Injection de 160 grammes de sang défibriné,arté- rialisé et chauffé à 50 centigrades. h. 11,10 min. = 39°,4) Respiraiion accélérée. ) ^ ^ p. 148. h. 11,13 min. == 39,8 ÏR.convulsive et plaintive j h. 11,15 min. = 39,8 Respiraiion plus calme, pouls 152. h. 11,20 min. = 39*,9 Respiraiion calme, pouls 84 inter-mittent de 2 à 2. h. 11,25 min. = 40 Respiration normale, pouls 84, même phénomène. h. 12 = 4i,5 Respiration normale, pouls 90. h. 1,35 min. == 39^6 Res()iration normale, pouls 90.A part quelques matières fécales sanguinolentes en petite quantité, renihies dans laprès midi, le chien na présente aucun phénomène remarquable. 40 DE LA TRANSFUSION DU SANG. Tracé graphique des varialions de la température pendant la 1^^ expérience. Text Appearing After Image: Huitième expérience. — 12 juillet. Injection de 160 gr.chauffés à 55° centigrades. Sang défibriné et filtré. Nousnavons pas tenu compte dans cette expérience de leau éva-porée. Le thermomètre marquait 55**,4 centigrades, aumoment de linjection, et celle-ci fut faite rapidement,h. 10,58 min. =^ 39°,9. P. 104. Soubresauts de la respirât,h. 11,2 min. = 40«,2. P. 132. R. fortement accélérée,h. 11,7 min. = 40,2. P. Il2. La respiral, redevient calmeenviron 5 minutes après lopération. Linjection terminée le chien ne paraît pas se porter plusmal; il se couche au soleil, dans la cour où il se trouve,reste parfaitement calme, agite la queue et prête attentionquand on lappelle. A une heure, il vomit trois fois, et dans un des vomisse-ments on trouve un petit caillot sanguin. A une heure quarante minutes, il urine du sang. A six heures, lurine est la même quà une heure qua- DE LA TRANSFUSION DU SANG. 41 rante minutes. Le lendemain Tanimal ne présente aucuntrouble et s Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 1098
Tags: bookdecade1870 bookcentury1800 booksubjectblood bookyear1874 booksubjectbloodtransfusion bookiddelatransfusiond00cass bookauthorcassejoseph bookpublisherbruxelleshenrimanceaux bookcontributorfrancisacountwaylibraryofmedicine booksponsoropenknowledgecommonsandharvardmedicalschool
1874

Image from page 190 of
Description: Identifier: pilotlorefromsai00unit Title: Pilot lore; from sail to steam Year: 1922 (1920s) Authors: United New York and New Jersey Sandy Hook Pilots Benevolent Associations National Service Bureau Allen, Edward L Subjects: Shipping -- New York (State) New York Pilots and pilotage -- New York (State) New York New York (N.Y.) -- Harbor Publisher: [New York] Contributing Library: University of California Libraries Digitizing Sponsor: MSN View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: cents a hundredpounds. One of the features of the plant is the provision that has beenmade for the accommodation and welfare of employees. There isan attractive two-story building designated as the LongshoremensClub. This is equipped with a restaurant and lounging rooms forstevedores and dock laborers. This makes it possible for the mento obtain without inconvenience properly cooked wholesome food ata reasonable price. It also provides a place for them to go duringspare time when the weather is inclement. An emergency hospitalis maintained by the Company for its employees and those of itstenants. Two other institutions also care for the employees, branches ofthe Y. W. C. A. and the Y. M. C. A. The Y. M. C. A. providessocial, athletic and recreational features. The building has bowl-ing alleys, billiard tables, a large gymnasium with full equipment,reading rooms and lounging rooms — 161 — ^ ^ ~ 1 g .5 X -a H «?• hrj s * -*^ 3. « > ST >- M a I! ^ a- 2 ^ & O Co O —» Text Appearing After Image: THE STATEN ISLANDSHIPBUILDING COMPANY BACK in 1895 a small group of men who had spent the greaterpart of their lives following the sea, decided that the Port ofNew York needed a steel shipyard. Their experience hadtaught them that a steel shipyard located in the port, could not helpbut be successful because of the great demand of harbor craft tosupplement the call for larger tonnage, which call became, as every-one knows, a paramount demand during the hectic }Tears from 1915-1920. That their venture was successful, the present plants of theStaten Island Shipbuilding Company stand ready to testify. Theman who pioneered this enterprise was W. J. Davidson, who is stilla most active president of this company. Associated with him atthe start were a few of the leading men of the old Starin yard ofwhom Messrs. Clute, Carney and Hinton were the leaders. Of theseassociates the latter two—Carney and Hinton—have recently died,while James Clute is at present one of the owners of the Company. Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 610
Tags: bookdecade1920 bookcentury1900 bookyear1922 bookpublishernewyork bookidpilotlorefromsai00unit bookauthorunitednewyorkandnewjerseysandyhookpilotsbenevolentassociations bookauthornationalservicebureau bookauthorallenedwardl booksubjectshippingnewyorkstatenewyork booksubjectpilotsandpilotagenewyorkstatenewyork
1922

Image from page 380 of
Description: Identifier: bostonoftodaygla01herna Title: Boston of to-day; a glance at its history and characteristics. With biographical sketches and portraits of many of its professional and business men Year: 1892 (1890s) Authors: Herndon, Richard, comp Bacon, Edwin M. (Edwin Monroe), 1844-1916, ed Subjects: Boston (Mass.) -- Description and travel Boston (Mass.) -- Biography Publisher: Boston, Post Publishing Company Contributing Library: The Library of Congress Digitizing Sponsor: Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: .,graduate of Wellesley in 1889 ; Grace; and DanielC. Linscott. Litchfield, George A., son of-Richard and Xoa(Clapp) Litchfield, was born in Scituate, Mass.,Aug. 21, 1838. His early education was attainedin the public schools and the academy at Hanover.He entered Brown University, but did not fullycomplete his college course. He studied for theministry and in 1861 was settled as pastor overthe Baptist church in Winchendon, Mass. Here heremained about five years, when, on account ofill-health, he was obliged to relinquish this work.Subsequently he turned his attention to the insur-ance business, and successfully engaged in the con-duct of a large life-insurance agency for westernMassachusetts. In 1874 he inirchase<l a half-inter-est in the tack and nail manuficturing concern ofISrigham, Whitman, & Co., in South Abington, thefirm name being changed to Brigham, Litchfield, &Vining. Then, in the fall of 1879, he again interestedhimself in insurance matters, and was concerned in Text Appearing After Image: GEORGE A. the establishment of the Massachusetts Benefit As-sociation, the leading company in New England 294 BOSTON OF TO-DAY. engaged in the mutual-assessment insurance busi-ness. He is still an active member of the board ofmanagers. Mr. Litchfield was married in SouthAbington Nov. 21, 1861, to Miss Sarah M. (nirney ;they have three children: Cannie Zetta, EverettStarr, and Frederick F^llsworth. Ln-ii.K, Arthur, architect, was born in liostonNov. 29, 1852. After finishing a course of studyat the Institute of Technology, he passed a year inthe office of Peabody & Stearns. He began thepractice of architecture in 1878, and until 1890continued alone, but in the latter year formed ajiartnership with H. W. Brown, under the firm nameof Little & Brown, the offices of the concern beingin the Mason Building, No. 70 Kilby street. Mr.Little has furnished plans for a number of handsomestructures, among them residences of George Howeat Manchester, two cottages at Swampscott for theLitde e Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 490
Tags: bookcentury1800 bookdecade1890 bookyear1892 bookidbostonoftodaygla01herna bookauthorherndonrichardcomp bookauthorbaconedwinmedwinmonroe18441916ed bookpublisherbostonpostpublishingcompany booksubjectbostonmassdescriptionandtravel booksubjectbostonmassbiography bookcontributorthelibraryofcongress
1892

Image from page 368 of
Description: Identifier: gri_33125001989728 Title: A history of painting in Italy : Umbria, Florence and Siena from the second to the sixteenth century Year: 1903 (1900s) Authors: Crowe, J. A. (Joseph Archer), 1825-1896 Cavalcaselle, G. B. (Giovanni Battista), 1820-1897 Strong, S. Arthur (Sandford Arthur), 1863-1904 De Nicola, G Borenius, Tancred, 1885-1948 Douglas, R. Langton (Robert Langton), 1864-1951 Subjects: Painting, Italian Publisher: London : J. Murray Contributing Library: Getty Research Institute Digitizing Sponsor: Getty Research Institute View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: than twenty-four panels, withthe Virgin and Child in its centre, in the oratory of San Martino 1 Louvre, No. 1,541, wood, 0.93 m. high by 0.52; on the basement of the throne :MCCCLiii. M. OT, The three last letters were once read as Maestro Ottaviano ; andthe picture on that account was assigned to Ottaviano of Faenza; but Mense Ottobrisis probably the true reading. The panel belonged to the Campana collection. 2 Venice, Correr Museum, Sala XV., 21. At the bottom of the panel: mccclxviiii,ADi. XI. AVOSTO. STEF, PLEii. scE. AGN. P. The figures are on gold ground. 3 Venice Academy, Sala I., 21, altarpiece, wood, 2.20 m. high by 2.85; thecentre-part from the Malin collection inscribed : mccclxxxi, stefak plebanvsSCE AGNET. PiNXiT. The Scenes from the Passion and the Legend of St. Francisfrom the church of Santa Chiara were erroneously ascribed to Semitecolo. * The signature is not genuine. ■* Milan, Brera, No. 166, wood, 0.91 m. high by 0.63. See MoscHiNis Guida diVenezia, ii., p. 486. Text Appearing After Image: Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 734
Tags: bookcentury1900 bookdecade1900 booksubjectpaintingitalian bookyear1903 bookpublisherlondonjmurray bookauthorcrowejajosepharcher18251896 bookauthorcavalcasellegbgiovannibattista18201897 bookidgri33125001989728 bookauthorstrongsarthursandfordarthur18631904 bookauthordenicolag
1903

Image from page 110 of
Description: Identifier: lacarrozzanellas00bell Title: La carrozza nella storia della locomozione Year: 1901 (1900s) Authors: Belloni, Luigi, 1914-1989 Subjects: Carriages and carts Locomotion Publisher: Milano, Torino, Roma, Fratelli Bocca Contributing Library: Smithsonian Libraries Digitizing Sponsor: Smithsonian Libraries View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: () Una statistica ufficiale del 31 dicembre 1810 dava come passate in questo annosulla strada del Moncenisio 2911 carrozze a molle o sospese ; 14037 vetture ; e 37250 ca-valli o muli. — CoMANDiNi, U Italia nei Cento Anni del Secolo XIX (1801-1900); A. Vallardi,Milano; pag. 464. — 71 — Ma la diligenza dallora era un veicolo poco diverso da quelli chesi possono vedere quasi ogni giorno davanti allOspedale Maggiorein Milano, e che trasportano i malati dai piccoli comuni di campagna,veicolo che in Francia fu detto umoristicamente coitcoti e fu aro^omentodi tante curiose e gustose caricature popolari. Text Appearing After Image: LInghilterra tra la fine del secolo XVIII ed il principio delsecolo nostro, fornì ogni genere più svariato di veicoli, per tutti igusti e per tutte le borse; e le donne tanto in Inghilterra che inFrancia si impadronirono ben presto delle redini, specialmente perguidare i cavalli delle vetture leggere, dei cabriolets; e questo sivide anche a Milano, e pare che accadessero deglinconvenienti, perchènon tardò a sopraggiungere unordinanza di polizia vietante alle donneed ai giovani di età inferiore ai i8 anni, di guidare i cabriolets, itilbury e simili. () Un tilbury italiano oltremodo curioso, a tre ruote, è possedutodalla fabbrica di carrozze Sala in Milano. È tutto dipinto ad oro,rosso e grigio; elegantissimo, su otto molle foggiate a spirale sulmodello della pila di Volta, allora riprodotta anche come oggetto dicuriosità, e porta a tergo il nome del costruttore, Antonio Bottigelladi Pavia Q. Le stampe ed i libri francesi ci hanno conservato tipi () Febbraio 1812. (-) CoMANDiNi, Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 656
Tags: bookcentury1900 bookyear1901 bookdecade1900 booksubjectcarriagesandcarts bookidlacarrozzanellas00bell bookauthorbelloniluigi19141989 booksubjectlocomotion bookpublishermilanotorinoromafratellibocca booksponsorsmithsonianlibraries bookcontributorsmithsonianlibraries
1901

Image from page 111 of
Description: Identifier: manualofpatholog00jone Title: Manual of pathological anatomy Year: 1875 (1870s) Authors: Jones, C. Handfield, (Charles Handfield), 1819-1890 Sieveking, Edward H. (Edward Henry), 1816-1904 Payne, Joseph Frank, 1840-1910, ed Subjects: Anatomy, Pathological Anatomy Pathology Publisher: London : Churchill Contributing Library: Francis A. Countway Library of Medicine Digitizing Sponsor: Open Knowledge Commons and Harvard Medical School View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: with difierencesof bodily constitution. SirJames Pagetf found in the fiuidderived from blisters in differentpersons very varying amountsof corpuscular elements, thenumber being generally in in-verse proportion to their healthand strength. These variationshe attributes to differences inthe condition of the blood.Eecent discoveries have ledsome rather to attribute themto variations in the facility withwhich blood corpuscles can leave the vessels, and these in allprobability to differences in the structure of the vascular walls.This view, however, cannot explain the difference between thebasis-substance of different specimens, which is made up of fibresin some and granular matter in others. Another variety of exu-dation, the licemorrhagic^ is distinguished by the abundance of redcorpuscles, though these, as we have seen, generally pass out ofthe vessels in small number. It has been thought that bloodpigment sometimes transudes without the corpuscles, but this hasnot been clearly proved. Text Appearing After Image: Fibrinous exudation on pleura in processof absorption : areolae form in it, and reduceit to filamentous bands. STJPPUUATION. We have next to consider that form of exudation in which thecells preponderate enormously, and in which the noncellular part * * Lelirbuch der Path. Anat., third edition, vol. i., p. ISfi.+ * Lectures on Surgical Pathology, second edition, p. 252. SUPPURATION, 97 is fluid, viz., pus, wliich, in the words of Eokitansky (loc cit.), hasbeen till now separated in an unnaturally sharp manner fromother exudations. There are many varieties of pus ; but that which is commonlycalled healthy (laudable) is that which we shall take for a typicaldescription. It appears to the naked eye as a creamy, thick,opaque, and homogeneous fluid; communicates an unctuous feel-ing when rubbed between the fingers; is of a yellow or whity-yellow tint; sweetish or insipid; and, while warm, gives oft apeculiar, mawkish smell. Its specific gravity i« 1-030-1-033. Ifallowed to stand some time Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 526
Tags: booksubjectanatomy bookdecade1870 bookcentury1800 booksubjectpathology booksubjectanatomypathological bookyear1875 bookpublisherlondonchurchill bookidmanualofpatholog00jone bookauthorjoneschandfieldcharleshandfield18191890 bookauthorsievekingedwardhedwardhenry18161904
1875

Image from page 53 of
Description: Identifier: peopleswarbookhi00mill Title: The people's war book; history, cyclopaedia and chronology of the great world war Year: 1919 (1910s) Authors: Miller, J. Martin (James Martin), b. 1859 Canfield, Harry S. [from old catalog], joint author Plewman, William Rothwell, 1880- [from old catalog] Foch, Ferdinand, 1851-1929 Lloyd George, David, 1863-1945 United States. President (1913-1921 : Wilson) Subjects: World War, 1914-1918 World War, 1914-1918 Publisher: Cleveland, O., The R.C. Barnum co. Detroit, Mich., The F.B. Dickerson co. [etc., etc.] Contributing Library: The Library of Congress Digitizing Sponsor: Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: The British Cavalry. They are seen charging over the top of a ridge galloping at full speed, 46 THE PEOPLES WAR BOOK passages connected the turrets, and some ofthese, in addition to their curvature, were Text Appearing After Image: General Byng, Hero of Cambrai in Famous TankCharge. of the disappearing type, in that the gunbases were raised for firing and then low- ■ered, offering small target for enemy fire. It was then that the most sensationalfeature of the long years of preparation inGermany was revealed. For a time thefortifications stood up under the attack ofthe enemy artillery, hut within a few hoursthe fii-st of the new type of howitzers hadheen hrought up and the military worldwas stunned ]\\- their effect. Of great range,their jjower was terrific and within forty-eight hours, Liege, defended by a few thou-sand men whose courage and sacrifice wrotea glorious chapter in the history of theirnative land, had fallen. General Leman inFort Loncin, showed a personal couragewliich was inspiration to the flaggingmorale of the Belgians, for he refused toleave his post, even while the great Germanshells brought the fortress toppling abouthim. Loncin was literally battered to piecesand Gen. Leman left for dead i Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 472
Tags: bookcentury1900 booksubjectworldwar19141918 bookdecade1910 bookpublisheretcetc bookyear1919 bookauthormillerjmartinjamesmartinb1859 bookidpeopleswarbookhi00mill bookauthorcanfieldharrysfromoldcatalogjointauthor bookauthorplewmanwilliamrothwell1880fromoldcatalog bookauthorfochferdinand18511929
1919

Image from page 181 of
Description: Identifier: hawaiianforester34hawa Title: The Hawaiian forester and agriculturist Year: 1904 (1900s) Authors: Hawaii. Board of Commissioners of Agriculture and Forestry Subjects: Agriculture -- Hawaii Periodials Forests and forestry -- Hawaii Publisher: Honolulu : Hawaiian Gazette Co. Contributing Library: The LuEsther T Mertz Library, the New York Botanical Garden Digitizing Sponsor: The LuEsther T Mertz Library, the New York Botanical Garden View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: ruit, but he was not the first one, for the paltaswere here in 1825. The wood of the Persca gratissinia is of fine grain and richcolor, and at one time was in great demand in England for fur-niture under the name of Barbados mahogany. Specimens inthe Bishop Aluseum from one of the large trees of Hilo cer-tainly show a pleasing cabinet wood. My object this evening, however, is not to describe all thehistory and good qualities of this favorite fruit, which I wishwe could call by its original Spanish-American name of Paltain place of the absurd avocado or lawyer pear, or the stupidcorruption alligator pear. I intend only to give you brieflysome of my experience in cultivating this fruit. We here areall too ready to merely plant the seed and do nothing more;we push the button and leave the rest to Providence. Thisinstitute is established, I believe, to help us to make someexertion ourselves, and by so doing better our products. In 1888 I was supplied with very good- paltas of the pur- 145 Text Appearing After Image: 146 pie variety grown by a friend in Pauoa valley. As these wereof one variety I selected the best fruits,—that is those thattasted best and had the best form without consideration of thebearing qualities of the parent tree. In 1890 I took six of themost vigorous plants resulting from these selected seeds tomy present residence on Judd street and planted all but onein the ground on the Ice side of the house, as this tree needsshelter from the winds, which are often strong in that part ofNuuanu valley. The soil was not originally good, and the place was rocky,but by blasting out the most objectionable ledges and replac-ing them with earth removed from the site of the house, wdiichwas then enriched with both natural and chemical manures,a fair chance was given the young trees, which grew well.The fruiting- results were curious. One on a more rocky bedproduced a small green fruit much inferior to the parent, andas the tree was in the way T cut it down. Another tree inperhaps the riches Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 728
Tags: bookcentury1900 bookdecade1900 bookyear1904 bookidhawaiianforester34hawa bookauthorhawaiiboardofcommissionersofagricultureandforestry booksubjectagriculturehawaiiperiodials booksubjectforestsandforestryhawaii bookpublisherhonoluluhawaiiangazetteco bookcollectionbiodiversity bookcollectionnybotanicalgarden
1904

Image from page 23 of
Description: Identifier: hygienedentalge00turn Title: Hygiene, dental and general Year: 1920 (1920s) Authors: Turner, C. E. (Clair Elsmere), 1890-1974 Rice, William Subjects: Hygiene Teeth Publisher: St. Louis, C. V. Mosby Contributing Library: The Library of Congress Digitizing Sponsor: The Library of Congress View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: the roots of the teeth as they develop afterthe eruption of their crowns and is removed by the processof absorption after the loss of any tooth. It follows, there-fore, that after the premature loss of a tooth and the removalof its supporting process, no stimulus remains for bone devel- 20 HYGIENE: DENTAL AND GENERAL opment; the continuity of the entire arch is broken and theteeth tend to drift in the direction of least resistance. Thisresults inevitably in the loss of the normal relationship be-tween the approximating surfaces of the teeth of each jawas well as the occlusal relationships of the teeth in opposingjaws. Serious deformity may follow. Smith has shown {Journal of the Allied Dental Societies,Vol. I, April, 1906) that in certain cases of malocclusion thetimely and well judged extraction of teeth may result bene-ficially by relieving the crowded condition. The tendency ofthe drift may then bring the surfaces of the remaining teethinto positions closely simulating the normal. Text Appearing After Image: Fig. 1.—Model illustrating normal occlusion. Orthodontia.—We agree with Johnson that the attainmentof the ideal normal occlusion of the teeth by orthodonticinterference is not always possible and in many cases anattempt to bring this about will result in an inharmony inthe relationship of the teeth to the general contour of thebony and muscular structures of the face which nature willnot tolerate. Not only will it be impossible to retain the teethin their new position, which is an abnormal one, but theremay ultimately result a deformity more objectionable thanthe original condition. Extensive orthodontic treatment DENTAL HYGIEXE 21 should be undertaken only after a careful study of all pre-vailing conditions by one whose vision is not limited to theteeth alone. It is futile to attempt to permanently establishideal normal occlusion when all the forces of nature are beingexerted to maintain the position of the teeth in their relation-ship to the organism as a whole. Development.—Lhygienedentalge00turn Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 613
Tags: bookdecade1920 bookcentury1900 booksubjecthygiene bookyear1920 bookpublisherstlouiscvmosby bookidhygienedentalge00turn bookauthorturnerceclairelsmere18901974 bookauthorricewilliam booksubjectteeth bookcontributorthelibraryofcongress
1920

Image from page 509 of
Description: Identifier: luzdaliberaleno00andr Title: Luz da liberal, e nobre arte da cavallaria : offerecida ao Senhor D. João, principe do Brazil Year: 1790 (1790s) Authors: Andrade, Manoel Carlos de Machado, Gaspar Fróis, 1759?-1796 Alegre, Manuel, 1768-1815 Silva, Joachim Carneiro da, 1727-1818 Portugal. Impressão Régia Subjects: Horsemanship Publisher: Lisboa : Na Regia Officina Typografica Contributing Library: Getty Research Institute Digitizing Sponsor: Getty Research Institute View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: o balanço do galope unido, pa-ra fe ir firmando fobre o efpinhaço, e quadris, rebatendo os movimentos bem pa-ra uma das ancas, e curvilhõcs, vai-lhe fuftendo cada vez mais o corpo atrás, e amão para fi , confcntindo fempre na fua galopada com toda a firmeza do feu cor-po, mãos, e pernas , porque íó defta forte he que fe obriga a formar o feu faltoquafi femelhante á Balotada hum pouco menos elevado do que ella , e algum tan-to mais levantado , e detido do que o terra á terra. Differe também de hum , ede outro em o Cavallo pôr as mãos no chão primeiro que os pés: e na Balotada,e terra á terra determina os feus movimentos com tanta celeridade , que parececUe põe na terra pés, e mãos ao mefmo tempo. O meio ar tira a fua denominação de fer hum falto , que elle forma entre oterra á terra , mais alto na fua elevação de efpaduas que elle , e menos elevadoque a Balotada. São poucos os Cavallos, que tem propensão para o movimento do meio £^liíf7zpa x^a 2^ar/ ,:j/jy. Text Appearing After Image: <yr/yrí í/f///i J^rti-Cj ^cu/yi Da Cavallaria. Livro VH. 357 meio ar pela qualidade do balanço, que devem fazer com as efpaduas, e garupa,a fim de rebater, e fazer recahir fobre as ancas a maior parte do pezo do feu cor-po pela força , e difpofiçao de órgãos , e mufculos de que necellltao , quando felevantão no balanço das efpaduas, para fe indireitar do ventre, foldras , e curvi-Ihôes , relevar-fe fobre ellc , e tornar-fe a comprimir fucceííívãmente, em quantofe continua o balanço das ancas para as efpaduas ; e pelo muito que fe detém , edobrão os travadouros, quando formão o falto defte galope , elles moftrão as fer-raduras dos pés , e mãos. ESTAMPA LVÍII. Do Seremjfimo Príncipe D, João, enfmanàó hum Cavalio na U^hdo mm ar, àobranào- o para a direita com o freio fó. COm os movimentos da mão, equilibrio, aíTento, joelhos, pernas , e final-mente com toda a fua bem fymmetriada figura, acorda S. A. humas com ou-tras fenfaçòes , em tudo próprias , e c Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 587
Tags: booksubjecthorsemanship bookpublisherlisboanaregiaofficinatypografica bookdecade1790 bookcentury1700 bookidluzdaliberaleno00andr bookauthorandrademanoelcarlosde bookauthormachadogasparfris17591796 bookauthoralegremanuel17681815 bookauthorsilvajoachimcarneiroda17271818 bookauthorportugalimpressorgia
1825

Image from page 225 of
Description: Identifier: bodyitsailmentsh00naph Title: The body and its ailments: a handbook of familiar directions for care and medical aid in the more usual complaints and injuries Year: 1876 (1870s) Authors: Napheys, George H. (George Henry), 1842-1876 Subjects: Publisher: Philadelphia, H. C. Watts & co. Contributing Library: The Library of Congress Digitizing Sponsor: The Library of Congress View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: more active, and in its line, nothing yields bet-ter results than to take some blood at the backof the neck by cups, either wet, that is, those that are used to draw the blood externally, orCupping back of _ . . . . Neck. dry, that is, where no cutting instrument is employed (see page 344). The location of the cups is shown in the above figure. Bruises, Blows, or Contusions, are flesh injuries where neither skin nor bone is broken. Cold and rest are the applications for them at first. For the former, see p. 342. To forestall a black eye, as soon as the blow is received, keep the part constantly wet with the spirit wash, p. 355, or the arnica lotion, p. 356. For jammed toes, or fingers caught in a window or door, the most speedy mode of procuring relief, immediately after the occurrence, is to plunge the finger into as hot water as can be borne. By so doing the nail is softened, and yields, or accommodates itself to the blogd poured out beneath it, so that the agony is soon diminished. Text Appearing After Image: Burns and Scalds. 223 The finger may then be advantageously wrapped up in a bread-and-water poultice. After the first pain and swelling of the bruise disappear, thediscoloration which remains may be dispersed by gentle and longrubbing with camphor liniment (p. 353). When a person is shaken and bruised all over, by a fall from ahorse, or the like, a warm bath gives great relief, if he is not faint. Burns and Scalds. These common accidents, by receivingearly and suitable attention, are often deprived of much of theirinconvenience. Of course, the first thing is to put the fire out,and then, if the injured parts require it, the clothing should be cutaway, so as to get at the entire extent of the injury with as littletrouble to the patient as possible. Should any fragment of gar-ment appear adherent to the burned surface, the sticking partshould be left, as the violence required to remove it must necessarilyincrease the damage to the injured part. Fig. 86. Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 468
Tags: bookyear1876 bookdecade1870 bookcentury1800 bookidbodyitsailmentsh00naph bookauthornapheysgeorgehgeorgehenry18421876 bookpublisherphiladelphiahcwattsco bookcontributorthelibraryofcongress bookleafnumber225 bookcollectionamericana booksponsorthelibraryofcongress
1876

Image from page 174 of
Description: Identifier: cu31924096989235 Title: The Roosevelt book; selections from the writings of Theodore Roosevelt Year: 1914 (1910s) Authors: Roosevelt, Theodore, 1858-1919 Subjects: Roosevelt, Theodore, 1858-1919 Presidents Publisher: New York, C. Scribner's Sons View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: d and woundedof the first fight, some had had to go to the hos-pital for sickness and some had been left behindwith the baggage, or were detailed on otherduty. Eighty-nine were killed and wounded:the heaviest loss suffered by any regiment in thecavalry division. The Spaniards made a stifffight, standing firm until we charged home.They fought much more stubbornly than at LasGuasimas. We ought to have expected this, forthey have always done well in holding intrench-ments. On this day they showed themselves to The Battle of San Juan Hill 133 be brave foes, worthy of honor for their gal-lantry. I think we suffered more heavily than theSpaniards did in killed and wounded (thoughwe also captured some scores of prisoners). Itwould have been very extraordinary if the re-verse was the case, for we did the charging;and to carry earthworks on foot with dismount-ed cavalry, when these earthworks are held byunbroken infantry armed with the best modernrifles, is a serious task. HUNTING WILD ANIMALS Text Appearing After Image: THEODORE ROOSEVELT,fn hunting costume. Taken about 1886. OLD EPHRAIM, THE GRISLY BEAR The king of the game beasts of temperateNorth America, because the most dangerous tothe hunter, is the grisly bear; known to the fewremaining old-time trappers of the Rockies andthe Great Plains, sometimes as Old Ephraimand sometimes as Moccasin Joe—the last inallusion to his queer, half-human footprints,which look as if made by some misshapen giant,walking in moccasins. Bear vary greatly in size and color, no lessthan in temper and habits. Old hunters speakmuch of them in their endless talks over thecamp-fires and in the snow-bound winter huts.They insist on many species; not merely theblack and the grisly, but the brown, the cinna-mon, the gray, the silver-tip, and others withnames known only in certain localities, such asthe range bear, the roach-back, and the smut-face. But, in spite of popular opinion to thecontrary, most old hunters are very untrust-worthy in dealing with points of natural hi Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 635
Tags: bookcentury1900 bookdecade1910 bookpublishernewyorkcscribnerssons bookauthorroosevelttheodore18581919 booksubjectroosevelttheodore18581919 bookidcu31924096989235 bookyear1914 booksubjectpresidents bookleafnumber174 bookcollectionamericana
1914

Image from page 60 of
Description: Identifier: silhouette191614agne Title: Silhouette (1916) Year: 1916 (1910s) Authors: Agnes Scott College Subjects: Agnes Scott College history Publisher: Agnes Scott College Contributing Library: Agnes Scott College, McCain Library Digitizing Sponsor: Lyrasis Members and Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: es fly! But we have not for-gotten how we felt that morning as we took our places in chapel oppositethe Seniors. There was now a sense of responsibility. The summit wasin sight. With what dignity did we hold aloof for the first time from theFreshmen-Sophomore fight, only a sisterly council advising the Freshmen.Study now took on a new meaning. There was a more real pursuit ofknowledge than when impelled by Freshman fear of flunking or Sopho-mores careless skinning through. And now it is the year of 1916! We have put on the insignia of ourrank and move demurely but consciously about our duties attired in a capand gown. The Freshmen let us pass first; we may be late to meals, havingarisen late from burning our Senior lights. There are Senior parties,Senior privileges, hard work, but encouragement from the faculty. Oh,but its great on the summit! There is a freer atmosphere and a widerviewpoint—and commencement—well, it is not the end of things, but justthe commencement! JosiE Jones. Text Appearing After Image: 3iL.HOi:jE:nnrE: i£nsit Mill nnh (LtBUmmt State of Georgia,County of DeKalb. Know all Men by These Presents, That we, the Senior Class of 1916of Agnes Scott College, in said State and County, being of sound mindand disposing memory, do make this, our last Will and Testament, herebyexpressly revoking any other Will that may have been made by us. Item I. To Mary P. Neff, Eloise Gay leaves her great talent forcollection, because said Mary Neff has, in the past, shown signs of abilityto use said gift to advantage. Item II. To Sarah Webster, Maggie Fields leaves her great lovefor Saturday night callers; to Mary Mclver, she leaves her red chiffondress, which becomes said Mary Mclvers coloring. Item III. To Marguerite Stevens, Elizabeth Burke leaves her angelicexpression, and her knowledge of how to wear veils in a becoming manner.This second item is of untold value and will be of great use to said Mar-guerite Stephens. Item IV. To Amelia Alexander, Alice Weatherly leaves her love forhard w Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 1263
Tags: bookcentury1900 bookdecade1910 booksubjectagnesscottcollegehistory bookyear1916 bookidsilhouette191614agne bookauthoragnesscottcollege bookpublisheragnesscottcollege bookcollectionamericana bookleafnumber60 bookcontributoragnesscottcollegemccainlibrary
1916

Image from page 144 of
Description: Identifier: analysisoffuelg00parruoft Title: The analysis of fuel, gas, water, and lubricants Year: 1922 (1920s) Authors: Parr, S. W. (Samuel Wilson), 1857- Subjects: Chemistry, Technical Fuel Grease Lubrication and lubricants Water Publisher: New York, N.Y. : McGraw-Hill Book Co. Contributing Library: Gerstein - University of Toronto Digitizing Sponsor: University of Toronto View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: s are provided with shut-off gates, so that thetreated water may be delivered entirely into one tank or the other. separately and as two distinct processes, in practice they arecombined into one operation; that is, the calculated amount oflime for treating, saj^ 1,000 gal. of raw water has incorporatedwith it the amount of soda ash as indicated by the sulphate orpermanent hardness per 1,000 gal., and the two reagents thuscombined are added directly to the water. Designed by G. M. Davidson,. Chemist and Engineer of Tests, Chicago& Northwestern Rj. Co. BOILER WATERS 129 Very many mechanical devices for automatically measuringthe correct amount of each reagent are in use, depending in themain upon the principle that a given weight or volume of theincoming raw water shall operate certain mechanical arrange-ments, whereby the proper amount of chemical is discharged intothe water. The devices are of two general types—the con-tinuous and the intermittent. In the continuous type the raw Text Appearing After Image: Fig. 26.— Chemical niixiriK and measuring device. ^ ■ The chemical is deliveredthrough the funnel, n, together with the raw water, passing through the pipe, o,into the tilting vessel, p. water flows into the apparatus and is discharged in the purifiedform ready for use. In the intermittent type the raw wateris made to flow through a mechanical measuring arrangement,whereby the chemicals in the proper proportion are added, afterwhich the water is brought into a large settKng tank for the timeelement to enter in for the accomplishing of the reaction involvedand also the settling out of the precipitates. Both types are 1 Designed by G. M. Davidson, Chemist and Engineer of Tests, Chicago& Northwestern Ry, Co.9 130 FUEL, GAS, WATER AND LUBRICATION effective, the essential point in any case being that the automaticdevices for measuring the reagents be exact and unfaiHng intheir operation. Illustrations are given of representative devicesfor each type. They have been selected primari Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 651
Tags: bookdecade1920 bookcentury1900 bookyear1922 booksubjectchemistrytechnical booksubjectwater bookidanalysisoffuelg00parruoft bookauthorparrswsamuelwilson1857 booksubjectfuel booksubjectgrease booksubjectlubricationandlubricants
1922

Image from page 166 of
Description: Identifier: howtoplaybasebal02murn Title: How to play base ball Year: 1905 (1900s) Authors: Murnane, T. H. (Timothy Hayes), 1852-1917 Subjects: Baseball Publisher: New York, American sports publishing co Contributing Library: The Library of Congress Digitizing Sponsor: Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: No. 3-0. Toe Plates.Per pair, 50c. Professional Best Quality SteelNo. 1. Toe Plates, lOcNo. IH. Heel Plates, 10c. No. 4-0. Heel Plates.Per pair, 50c. League Hardened SteelNo. 0. Toe Plates, 25c.No. 2-0. Heel Plates, 25c. Spalding Pitchers Toe Plate Text Appearing After Image: Aluminum,Brass, . A thorough protectionto the shoe and a mostvaluable assistant inpitching. ]\Iade for rightor left shoe. Used by allprofessionals. Each, 50c Each, 50c! C (U> ^_J) A. C. SPALDING & BROS. ifNewYork Chicago St. Louis Denver San Francisco Boston Minneapolis Baltimore Kansas City New Orleans Buffalo Philadelphia Washington Pittsburg Syracuse CincinnatiMontreal, Can. London, England I New ^ I Bostor Buffal ASPECIALAWARD^r GRAND PRIZE B were won by A. G. SPALDING & BROS, at the LouisianaPurchase Exposition, 1904, for the best, most completeand most attractive installation of Gymnastic ApparatiBase Ball and Athletic Supplies shown at the Worlds II let us,^^^ (T =DG= S\ Spalding Club Special Shoe Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 469
Tags: bookcentury1900 bookdecade1900 booksubjectbaseball bookyear1905 bookidhowtoplaybasebal02murn bookauthormurnanethtimothyhayes18521917 bookpublishernewyorkamericansportspublishingco bookcontributorthelibraryofcongress booksponsorsloanfoundation bookcollectionamericana
1905

Image from page 154 of
Description: Identifier: notablemenofillichic Title: Notable men of Illinois & their state Year: 1912 (1910s) Authors: Subjects: Bankers Industrialists Lawyers Merchants Municipal officials and employees Pharmacists Physicians Real estate agents State governments Publisher: [Chicago] : Chicago Daily Journal Contributing Library: Lincoln Financial Foundation Collection Digitizing Sponsor: The Institute of Museum and Library Services through an Indiana State Library LSTA Grant View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: > ^^O _^ TT ,rh S . m S oj ♦^ . _ • -01 r ^ac;!^o..fl,:,a J go Optica a39h 5a|s.o-£«^s £[3 >,a> o =■§§5 ic^~ ■J CJ tr D.^ ^ oj o ua i^^^^^^^^^^^H^^^^^^^^^^^^^^^^^^^^^^H$;l A^^^^H^^^^^^^^^^^^^^^^^^^^^B^ ■ ^^Hl^^^^l ^^^^^g^^HBE^^^^^HuL ^ ..JB «P ---^ . ^ 1 ^^ppiin-^^^ 1 I e ^ ^ Sis =3 5 =« -o Hte c30 - >-:, ^ rf te OJ ..J. A •• ^O OO ■ U (D C3 •^ 13 -J aj ^ mO-5 >M r*, -b «H-. -fj m K^i* -...-0113 = 0- ^■S .£- ^ 5h m y h ^ 132 Text Appearing After Image: ^■-305 c- =^ is -T3 -S:r. t: S; a^ = S33 . - 5 :o V ^ o ^ ^■o ■ X -- gi: =B a ffl m ,S 3aa2^ ■ ^o^ o X — rt - 1 X -i: ^ M Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 771
Tags: bookcentury1900 booksubjectphysicians bookyear1912 bookdecade1910 booksubjectlawyers bookidnotablemenofillichic booksubjectbankers booksubjectmerchants booksubjectmunicipalofficialsandemployees booksubjectpharmacists
1912

Image from page 546 of
Description: Identifier: transylvaniaitsp00bone Title: Transylvania; its products and its people. With maps and numerous ills. after photographs Year: 1865 (1860s) Authors: Boner, Charles, 1815-1870 Subjects: Publisher: London Longmans, Green, Reader, and Dyer Contributing Library: Robarts - University of Toronto Digitizing Sponsor: University of Toronto View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: I was in the country. SOUTHWARDS. >09 vince, tlien absent, and as I had a letter to his secretary Idrove up to the fortress. I was lodged as though I hadmyself been a bishop; and in the handsome apartmentssurrounded at table by the gentlemen of the chapter, andwith marked attention shown me as to an honouredguest, I almost began to fancy I had been under a de-lusion hitherto, and that I was in reality a high dignitaryof the Church. If so, it was dangerous to tarry here toolong, for I was living as at a court, and in such style andprofusion, that my heart could hardly fail to be puffed upwith pride, ill becoming an ecclesiastic. Karlsburg, aswas said, is famous for its wines; and of these at everymeal a variety was served. The soil of the vineyardshere is clay and limestone. The fortress is large, with streets and a square, andgood-looking buildings; there also is the Mint, an ob-servatory and a library, rich in MSS. and illuminatedworks. The academy now in Enyed was formerly here. Text Appearing After Image: But the cathedral dedicated to St. Michael is themonument of chief interest; it is the most importantchurch edifice existing in Transylvania of the period ofthe Komanesque style of architecture. It was built in 510 TRANSYLVANIA. 1275. The side aisles are low, and separated from thenave by massy columns rising out of a square base. The «^lil / IP V-Ill II Mum iMHiiIP \ -( iHB 3!B ii dawn i\ I • = :i!i:&!w»!f!fl!;il groins of these side arches rest sometimes on mouldings SOUTHWARDS. 511 iii the outer wall, tastefully ornamented with leaves andflowers. The capitals of the columns are all richly carvedwith tufts of fruit and leaves, in endless variety, whilesome on the north side display human heads and birds in fantastic intertwinings. .Mm iii 11 Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 1050
Tags: bookcentury1800 bookdecade1860 bookyear1865 bookidtransylvaniaitsp00bone bookauthorbonercharles18151870 bookpublisherlondonlongmansgreenreaderanddyer bookleafnumber546 bookcontributorrobartsuniversityoftoronto booksponsoruniversityoftoronto bookcollectionrobarts
1865

Image from page 70 of
Description: Identifier: thackerayana00greg Title: Thackerayana; Year: 1875 (1870s) Authors: Grego, Joseph, 1843-1908, comp Thackeray, William Makepeace, 1811-1863, illus Subjects: Thackeray, William Makepeace, 1811-1863 Thackeray, William Makepeace, 1811-1863 Thackeray, William Makepeace, 1811-1863 Novelists, English Publisher: London, Chatto and Windus Contributing Library: The Library of Congress Digitizing Sponsor: The Library of Congress View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: ROLLINGS ANCIENT HISTORY. 47 decided the resolutions of that monarch. He assisted the kingto discover on which side victory might be reasonably expected Text Appearing After Image: to turn, and showed him how much safer it would be to trustto the friendship of the Romans rather than rely on that ofAntiochus.—Vol. VIII. p. 426. Funeral Obsequies of Philopoemen. *. . . When the body had been burned, and the ashes weregathered together and placed in an urn, the cortege set out to Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 130
Tags: bookdecade1870 bookcentury1800 bookyear1875 bookidthackerayana00greg bookauthorgregojoseph18431908comp bookauthorthackeraywilliammakepeace18111863illus booksubjectthackeraywilliammakepeace18111863 bookpublisherlondonchattoandwindus booksubjectnovelistsenglish bookcontributorthelibraryofcongress
1875

Image from page 10 of
Description: Identifier: scientific-american-1902-03-29 Title: Scientific American Volume 86 Number 13 (March 1902) Year: 1902 (1900s) Authors: Subjects: steam automobile electric american tbe patent motor scientific zodiacal light scientific american morning star lower ends rapid transit portland cement sailing vessels park avenue american march horse power Publisher: View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: into a motor-sled by simplysubstituting a pair of runners for the front wheel.Mr. I. H. Whipple, the designer and owner of thispeculiar vehicle, delights to race his machine againstthe fast horses on Chicagos speedway, which he caneasily outdistance. The machine is a convertedMitchell motor-bicycle driven by a 2 horse powermotor and said to develop a maximum speed ofthirty-five miles an hour. As a motor-sled, however,the inventor claims a speed of forty miles an hour.By having two parallel runners in front an uprightposition is assured to the machine and the steeringof the machine easily controlled. The runners areattached to a cross-bar secured to the front forks, andare adapted to be removed in summer time. The cross-bar, however, may be retained and serve as an axleon which a pair of wheels may be mounted, thus con-verting the machine into a tricycle. An additionalseat may be added at the front of the machine if de-sired, the motor having ample power to propel theadditional weight. Text Appearing After Image: K^J A HEW WATER-LEVEL REGULATOR FOR STEAMBOILERS. The accompanying illustrations give a general viewand cross section of a very simple automatic appar-atus for regulating the water level in a steam boiler.The device has just been patented by Mr. NelsonCurtis, of Boston, Mass., who invented it for use onautomobiles, although it is readily applicable to anysteam boiler. This regulator is constructed to operate by the well- .known principle in hydrostatics that a column of liquid of a given height, however small in diameter, will counterbalance or lift a great weight, provided it acts against a sufficient area at its base. An inspection of the diagramwill show the reader that theupper half of the vertical stem,above the connection with theboiler, consists of three tubesnumbered 1, 2 and 3 from theoutside, inward. The second ofthese tubes terminates below inthe upper part of the diaphragmchamber, D, while the third onepasses through the flexible phos-phor bronze diaphragm and end?in the l Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 995
Tags: bookcentury1900 bookdecade1900 bookyear1902 booksubjecttbe bookidscientificamerican19020329 booksubjectzodiacallight booksubjectmorningstar booksubjectlowerends booksubjectsailingvessels booksubjectparkavenue
1902

Image from page 291 of
Description: Identifier: surveyaprsep1918surv Title: The Survey April-September 1918 Year: 1918 (1910s) Authors: Survey Associates Charity Organization Society of the City of New York Subjects: Charities Social problems Publisher: [East Stroudsburg, Pa., Survey Associates] Contributing Library: Robarts - University of Toronto Digitizing Sponsor: Algoma University, Trent University, Lakehead University, Laurentian University, Nipissing University, Ryerson University and University of Toronto Libraries View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: $1.00per month until $8.50 in all is paid. How 200 Children Live and Learn By R. R. Reeder Superintendent of the Cottage Homes and School ofthe Orphan Asylum Society in the City of New York. An illuminating study of life and education in acottage institution. Price $1.25. By mail, $1.35 THE SURVEY 112 East 19 Street New York Essential to Health andComfort Mattress Protectors are necessary for cleanliness ofthe Mattress. No good housekeeper considers her bed rightlyequipped without Mattress Protectors. A sheet in itself cannot properly protect the Mattress. During sleeping hours the body in complete reposethrows off waste tissues and gases, much of whichpenetrate the sheet and are absorbed by the Mattressif not properly protected. Our Quilted Mattress Protectors are made from purewhite wadding incased in bleached white muslineasily washed whenever necessary. Dry out light and fluffy asnew. They protect your Mattressfrom all impurities andlengthen its life.A single trial will convince. Text Appearing After Image: Insist on seeing our trademark and name—Excel-sior Quilted MattressProtector—on each Pro-tector. None genuine withoutTrade Mark Excelsior Quilted Mattress Co, 15 Laight Street/New York, N. Y. HOUSES SUPPLYING INSTITUTIONAL TRADE Dry Goods FREDERICK LOESER & CO.484 Fulton Street, Brooklyn, N. Y. Groceries SEEMAN BROS. Hudson and North Moore Sts., New York Hardware, Tools and SuppliesHAMMACHER SCHLEMMER & CO.Fourth Ave., Thirteenth St, New York Electric Clock Systems LOCKWOOD & ALMQUIST. Inc.112 East 19th Street, New York City [ADVERTISEMENT] THE SURVEY FOR JUNE i, 191 277 Classified Advertisements WORKERS WANTED WANTED—Social Worker of some ex-perience for small city in Central Illinois.Address 2802 Survey. ^__ WANTED—Educated woman, thorough-ly experienced as Superintendent ChristianInstitution. New England. Address 2804Survey. WANTED —Swimming Instructor forMens Department, preferably beyond draftage. Write particulars, covering age, edu-cation, experience, and Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 1253
Tags: bookcentury1900 booksubjectcharities bookdecade1910 bookyear1918 bookidsurveyaprsep1918surv bookauthorsurveyassociates bookauthorcharityorganizationsocietyofthecityofnewyork booksubjectsocialproblems bookpublishereaststroudsburgpasurveyassociates bookcollectionontariocounciluniversitylibraries
1918

Image from page 34 of
Description: Identifier: Bates_Student_1913 Title: Bates Student Year: 1913 (1910s) Authors: Bates College Subjects: Publisher: Lewiston, Me. : Bates College Contributing Library: Bates College, Edmund Muskie Archives and Special Collections Library Digitizing Sponsor: LYRASIS Members and Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: BRADBURY & MARCOTTE MANGAN, The Tailor 119 LISBON STREET Agent, KUAN MRNSFIELD 14 PARKER HALL THE FISK TEACHERS AGENCIES EVERETT O. FISK & CO.,Proprietors * 2A Park St., Boston, Mass. 508 Colorado Bldg., Denver, Col.156 Fifth Ave., New York, N. Y. 316 Journal Bldg., Portland, Ore.1847 U Street. Washington, D. C. 2161 Shattuck Ave., Berkeley, Cal.28 E Jackson Boul., Chicago, 111. 343 Douglas Bldg., los Angeles, Cal. Text Appearing After Image: (Tople? Square Ufotel Huntington Avenue, Exeter and Blagden Streets BOSTON, MASS. Headquarters for college and school athletic teams when in Boston 350 Rooms. 200 Private Baths AMOS H. WHIPPLE, Proprietor THE BATES STUDENT T5he BridgeTeachers * Agency HAS PROCURED FOR GRAD-UATES OF BATES COLLEGE335 POSITIONS, AT SALARIESFROM $2,300 DOWN Agency Manual andRegistration BlankFree on Application C. A. SCOTT & CO., Props Room 44 i Tremont BuildingBOSTON • Write Ideas For Moving Picture Plays! ^V^tf~fc¥ T CAN WRITE PHOTO PLAYS AND■ EARN $25.00 OR MORE WEEKLY We Will Show You How! If you have ideas—if you can think—we will show you the secrets of this fascinating new profession. Posi-tively no experience or literary excellence necessary. No flowery language is wanted. The demand for photoplays is practically unlimited. The big film manufacturers are moving heaven andearth in their attempts to get enough good plots to supply the ever increasing demand. They are offering $100and mo Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 698
Tags: bookcentury1900 bookdecade1910 bookyear1913 bookidbatesstudent1913 bookauthorbatescollege bookpublisherlewistonmebatescollege bookcollectionamericana bookleafnumber34 booksponsorlyrasismembersandsloanfoundation bookcontributorbatescollegeedmundmuskiearchivesandspecialcollectionslibrary
1913

Image from page 113 of
Description: Identifier: iris1911ward Title: Iris 1911 Year: 1911 (1910s) Authors: Ward Seminary (1865-1913) Subjects: School yearbooks -- Tennessee -- Nashville Ward Seminary (Nashville, Tenn.) – Periodicals Girls' schools -- Tennessee -- Nashville Education, Primary – Tennessee – Nashville Education, Elementary – Tennessee – Nashville Education, Secondary – Tennessee – Nashville College preparatory schools – Tennessee – Nashville Junior colleges – Tennessee – Nashville Boarding schools – Tennessee – Nashville Women's colleges -- Tennessee – Nashville Women -- Education -- Tennessee -- Nashville -- 1865-1951. Publisher: Ward Seminary Contributing Library: Harpeth Hall School Digitizing Sponsor: Lyrasis Members and Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: ALABAMA CLUB Colo7-s: Crimson and White Alabama Club YellRac-axoc!Sis-a-boom-bah!Alabama! Alabama!Rah! Rah! Rah! Flower: Cotton Blossom Officers Kate Echols President Mabel Rainey Vice President Mary Douglass Treasurer Ruth Trigg Secretary Members Viola Bradley, HuntsvilleMary Douglass, Birmingham Eugenia Everette, HuntsvileKate Echols, Decatu- Josephine Johnson, Gadsden Mabel Rainey, Jasper Nettie Thomas, Albertville Allie Mae Snodgrass, Scottsboro Ruth Trigg, Blocton Matsie Wa rte n, Athens Louise Warten, Athens Mildred Wells. Huntsville MOLLIE Wilson, Gadsden , Text Appearing After Image: ARKANSAS CLUB Arkansas Club Colors: Green and White Floioer: Apple Blossom Motto: Never huiry Officers Catherine McKay , President Lucy Doris Phillipps Vice President Hazel Dean Secretary and Treasurer Members Sallie M. Bain Portland Hazel Dean Hamburg Catherine McKay Fort Smith Lucy Doris Phillipps Malvern Stella B. Waldhoff ..._:.:,: Hazel Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 1277
Tags: bookcentury1900 bookdecade1910 bookyear1911 bookidiris1911ward bookauthorwardseminary18651913 booksubjectschoolyearbookstennesseenashville booksubjectwardseminarynashvilletennperiodicals booksubjectgirlsschoolstennesseenashville booksubjecteducationprimarytennesseenashville booksubjecteducationelementarytennesseenashville
1911

Image from page 257 of
Description: Identifier: historyofcityof00lamb Title: History of the city of New York: its origin, rise and progress Year: 1896 (1890s) Authors: Lamb, Martha J. (Martha Joanna), 1829-1893 Harrison, Constance Cary, "Mrs. Burton Harrison,", 1846-1920 Subjects: New York (N.Y.) -- History Publisher: New York : A. S. Barnes and company Contributing Library: University of California Libraries Digitizing Sponsor: MSN View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: his country throughout theRevolution. His wife and beautiful daughter,Catharine (born in 1760), fled to Morristown,New Jersey, during the oceupation of NewYork by the English. It was this Miss VanZandt who was one of the leading V)elles at theInauguration Ball of our first President, andmariied, in 1788, James Homer Maxwell, sonof the founder of the first banking establish-ment in New York. In 1796, Louis Philippe, ~-while in New York, was entertained by Wy-nant Van Zandt (3d), and after his return toFrance wrote an autogi-aph letter of thanks for ~~the hospitality shown him, sending at the same ^ time to Van Zandt a beautiful watch-seal as -Sa token of appreciation and remembrance, of which the sketch is a careful copy. ^ Gift from Louis Philippe dOrleans to Wynant Van Zandt *- ^ m 1796. 1 Rev. David Clarkson was born at Brad-ford, England, in 1622, and completed his studies at Cambridge University about 1642. He Text Appearing After Image: Watch Seal. THE CLAEKSONS OF NEW YORK. 35 and seen much of the world. He married, in 1749, Elizabeth French, thesister of Mrs. William Livingston and Mrs. David Van Home. Shortlyafterward he built upon the Clarkson property, corner t)f Whitehall andPearl streets, an elegant mansion, which was considered at the time an ornament to the metropolis, but which was swept away by the greatfire of 1776. It was sumptuously furnished, some of the European impor-tations consisting of beautiful curtains, and stuffed sofas and easy-chairs(made in Loudon), mirrors in carved gold frames, works of art, por-traits, ancient relics, fine table-service in costly porcelain, cut glass, andsilver plate, and a library embracing the popular novels and standardworks of the day.^ The household servants, as in many other of the New mairied Elizabeth, daughter of Sir Henry Holcraft, Knight, M. P., etc., and Lattice, daughterof Francis, Lord Aungier, who was of the same family as the sovereigns of England. Theirso Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 1248
Tags: bookcentury1800 bookdecade1890 bookyear1896 bookidhistoryofcityof00lamb bookauthorlambmarthajmarthajoanna18291893 bookauthorharrisonconstancecarymrsburtonharrison18461920 booksubjectnewyorknyhistory bookpublishernewyorkasbarnesandcompany bookcollectionamericana bookleafnumber257
1896

Image from page 147 of
Description: Identifier: pacifictouristwi00will Title: The Pacific tourist : Williams' illustrated trans-continental guide of travel, from the Atlantic to the Pacific Ocean : containing full descriptions of railroad routes across the continent, all pleasure resorts and places of most noted scenery in the far West, also of all cities, towns, villages, U.S. Forts, springs, lakes, mountains, routes of summer travel, best localities for hunting, fishing, sporting, and enjoyment, with all needful information for the pleasure traveler, miner, settler, or business man : a complete traveler's guide of the Union and Central Pacific Railroads and all points of business or pleasure travel to California, Colorado, Nebraska, Wyoming, Utah, Nevada, Montana, the mines and mining of the territories, the lands of the Pacific Coast, the wonders of the Rocky Mountains, the scenery of the Sierra Nevadas, the Colorado mountains, the big trees, the geysers, the Yosemite, and the Yellowstone Year: 1877 (1870s) Authors: Williams, Henry T Subjects: Union Pacific Railroad Company Central Pacific Railroad Company Publisher: New York : H.T. Williams Contributing Library: Harold B. Lee Library Digitizing Sponsor: Brigham Young University View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: reduce each about 1,100bushels of charcoal, for which the proprietorgets 25 cents per bushel,—a business of about$50,000 per year is done. The Silver Mine wasonce estimated extremely rich, and was sold ^ foran enormous figure, to New York capitalists,of which Messrs. Howland and AspinwaU werespecially interested. The American Fork CanonRailroad was built to facilitate the carrying ofthe ores,—and just as the road was completed,and upward of $500,000 spent, the pocketgave out. At present the mine is said to yieldwith lead, only about 35 ounces per ton ofsilver. At Deer Creek is a lovely picnic groye, purespring water, and for those of good wind andlovers of adventure,—an opportunity for mount-ain climbing. The total length of the canon to this point, is12 miles, and the total length of the railroad, is16 miles,—cost about $400,000, and the mostsolidly built narrow gauge railroad in theUnited States. The total ascent in elevationfor the whole railroad, is nearly 5,000 feet, and Text Appearing After Image: SCENES IN AMERICAN FORK CANON. 1.—Mt. Aspinwall, or Lone Mountain. 2.—Rock Summits. 3.—Picnic Grove, Deer Creek. 4.—A quiet Glen. 5.—Hanging Rock. 6.—Rock Narrows. the average grade of the railroad is 306 feet.This is the steepest railroad grade in the UnitedStates, and the only grade over 200 feet ascendedby a locomotive. Tourists who have enjoyed so fine and glori-ous a ride up the canon hither, will perhaps ex-pect that the return will be tame. They will bemost pleasantly surprised and disappointed, for itis the grandest of all railroad scenes they will everwitness. Detaching the locomotive from the train, theconductor stands at the little brake, and withouta signal or help, the little cars of the trainquietly start on their downward journey, alone.Gliding down with increasing speed, roundingthe curves with grand and swinging motion, thebreeze fanning your face, and the beautiful,pure mountain air stimulating your spirits tothe highest limits of exhilaration, your feeli Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 12163
Tags: bookdecade1870 bookcentury1800 booksubjectcentralpacificrailroadcompany bookpublishernewyorkhtwilliams bookyear1877 bookidpacifictouristwi00will bookauthorwilliamshenryt booksubjectunionpacificrailroadcompany bookcontributorharoldbleelibrary booksponsorbrighamyounguniversity
1877

Image from page 78 of
Description: Identifier: locomotiveengine07hill Title: Locomotive engineering : a practical journal of railway motive power and rolling stock Year: 1892 (1890s) Authors: Hill, John A. (John Alexander), 1858-1916 Sinclair, Angus, 1841-1919 Subjects: Railroads Locomotives Publisher: New York : A. Sinclair, J.A. Hill [etc.] Contributing Library: Carnegie Library of Pittsburgh Digitizing Sponsor: Lyrasis Members and Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: d wi tablished systems, and that the methods I made some inquiries, and learn that it look, cnssed everything in sight , employed by them were approved practi- is not an uncommon occurrence to have live tone thai l d h h 1 cably by all the air-brake experts who had the brakes fail to set while backme in this a sad loss or a JL^ hi.,, l.^^ ..Tl!!!!anything to do with them. The brakes on the train I came in on reasons for such faSurcs did not seem to bear this out. but on com- background. If the men v vas thusiastic in trying to beat tL ^, attracted by a man who made up the pas- handling his brakes would only invc senger trains for the road. He was a before they practice, they would sooi hustler, and one of bis duties was to that the engineers brake-val- act OS a yard conductor, taking the main reservoir in either releai jestures he made him marked M: that planatiBed, pip ed of poundif his tra the cng ut. Wh en Sam i vUh valve on ap. close ing po ot; the blow Jl S urned b ackand ( 1 JL^ Text Appearing After Image: 2 depot to the yard. While riding upi yard he told some vtries of how he backedthe largest depots in ars. and never had but one acciijent, welllen the brakes, after working well till plica;y reached Ihe depot, refused to take duce the braking poiId, and he came near being killed in the practically useless-ash-up; and at the investigation he Roanoke. Va.lid learn nothing of what the matter^ht be, but was told that he did right in;ning the backing whistle to set the le had one ot this kind of hose with Mr. C. E. Conger in November1, with a pipe and stop-cock, but had gives a batch o£ kinks that for the ^ ■ would -had the boys in the corner. but easy enough when found out. It brings accident. Telling him I would think itover, I got on the engine of the next trainbacking down ; the hostler who took the since, and the eested party mayagined from the xtenl to which an inter-be befuddled can beim-condensed history of the the picturegust so Ion engine looked very much disgusted withhis job Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 1030
Tags: bookcentury1800 bookdecade1890 bookyear1892 bookidlocomotiveengine07hill booksubjectrailroads bookauthorhilljohnajohnalexander18581916 bookauthorsinclairangus18411919 booksubjectlocomotives bookpublishernewyorkasinclairjahilletc bookcollectionamericana
1892

Image from page 40 of
Description: Identifier: bestiolesamiques00lope Title: Bestioles amiques per Affonso Lopes-Vieiva; I. Ribera- Rovira; Farran Maristany; Year: 1920 (1920s) Authors: Lopes Vieiva, Alfenso Subjects: Publisher: Barcelona : "Ferrantes R. Catalunya Contributing Library: New York Public Library Digitizing Sponsor: msn View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: OLIDETS, Els burrets, Van seguint els caminets. Van trescant pels caminals,Pels llarguíssims camí-rals. Porten llenya, porten sacs,I ho soporten tan manyacs! 37 BESTIOLES AMIGUES Porten coses a mercat,Dins lalforja carregat. I ho transporta bé, el burret,Amb un pas tot menudet. Menudet, Però molt segú; Seguidet, Que no latrapa ningú. I treballa adelerat Amb seny i amb humilitat. 3S BESTIOLES AMIGUES Els burrets, Polidets, Sempre van Caminant «Tras-tras-tras» Treballant, Rumiant, Sense moures del seu pas. Del seu amo què seriaSense el burret? Ouè farfa? Què faria, malhaurat.Sense el seu fidel criat? 39 BESTIOLES AMIGUES ^S^ I això que moltes vegadesEl seu amo, si és dolent,Me li venta de valentGarrotades! I ell, cl burret sofridó,No diu res, el pobriçó.En els ulls porta el perdó! Sha cregutMolta gentQue el burret,Lasenet, 40 Text Appearing After Image: 41 BESTIOLES AMIGUES EI ruquet, Es molt poc intel•ligent. No ho cregueu!Què us penseu! Al cap-davall Es més savi que el cavall. Menja poc, Menja agram, Per entretenir la fam: 43 BESTIOLES AMIGUES I una herveta, Un lletsonet, Ja fa content el burrct! 44 Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 434
Tags: bookdecade1920 bookcentury1900 bookyear1920 bookidbestiolesamiques00lope bookauthorlopesvieivaalfenso bookpublisherbarcelonaferrantesrcatalunya bookcollectionamericana bookcontributornewyorkpubliclibrary bookcollectionnewyorkpubliclibrary bookleafnumber40
1920

Image from page 341 of
Description: Identifier: ilzodiacooveride00oril Title: Il zodiaco, over, idea di perfettione di prencipi : formata dall'heroiche virtù dell'illvstriss. et eccellentiss. signore D. Antonio Alvarez di Toledo, duca d'Alba vicere di Napoli : rapresentata come in vn trionfo dal fidelissimo popolo napoletano : per opera del dottore Francesco Antonio Scacciauento suo eletto : nella pomposissima festa di San Gio. Battista, celebrata à 23. di giugno 1629. per il settimo anno del suo gouerno Year: 1630 (1630s) Authors: Orilia, Francesco, 17th cent Scacciavento, Francesco Antonio Beltrano, Ottavio, fl. 1640 Subjects: Alba, Antonio Alvarez de Toledo, duque de, 1585-1639 Alba, Dukes of Festivals Triumphal arches Zodiac Virtues Emblems Publisher: In Napoli : Appresso Ottauio Beltrano Contributing Library: Getty Research Institute Digitizing Sponsor: Sloan Foundation View Book Page: Book Viewer About This Book: Catalog Entry View All Images: All Images From Book Click here to view book online to see this illustration in context in a browseable online version of this book. Text Appearing Before Image: ndimeno alla Face. E fi magnantma^che non ambi/ce carichihaparticolar genio alla GtuHàia,^ all uguagliarza, è nemicodelle nouità abb.rrifce le zfurpationi. Éper quel chejpetta 4//-elTer lontano de gli aggraui\ye delle offe fé e ui dente mente tutte /fue attioni Ihan dimoftrato. Non ha tolto la rohba à/udditt^ha te-nuto miril particolar alla conjeruatione delle perfidine , e delhonorloro^preferendolo ad ogni altra cuja. ^uejie^ altre applicationni facendo detto Scrittorey ha chiaramente dimoftrato il Duca^dAlua ejJereJÌAto efficacijjìmojlr omento à conjeruarla Face ìtl^Italia.. Obligato à quejìo beneficio ilFid, Fop. Napoletano nellaprima facciata dellArcOfCollo co in -un quadro i;n ritratto del Du-ca armato colbafton di Generale alla de/ir a , e premente co piedialcune Uncierottey^ nella bafe rotonda/opra della quale fi fer^maua fimagineyerano anco invn ouato dipintigli arbori aelColi^uoycdelU Falmaifimbolidi Vittoria, e di Pace* LElogio etàil/eguente • rt -ANs Text Appearing After Image: DI PERFETTIONEDI PRENCIPI 33XANTONIO TOLETO REGNI PAGATORI. Aurei facculi Reparatori,Eunomia?,Vrbiu feruacricis Propugnatori, Dum per has fedes (ancico f^edere Dicen , & Irenem, luftidan:ìj&: Pacem.circumducit: OlliThauHiantias verficolore luminc Capuc irradiar. Pop. Plaufu Parthenopei, ^A D, /intonìo Toledo cuftode della publica Fac^f ri faro del/èco lo deUoro y delle buone legghche la Città con/emano Cofjferjtatore 9 ^ * • Mentre difireti./simo nodo congiuntela Gfu/ittiaye la Paceaccompagnano ilfuo trionfo: ^aumantidedifuot ^variati) e cele/li coloriil corona»el Fid. Pop, Nap. gli applaude. Dair altra facciata in vn co fmil quadro era delineata lima»gine della Pace coromta alla nde.^ejta con la deftra tenendo*vnaj;.ceacce/aabbruciaua vn cunolod^irn^heconla^ni/tafo»fteneua il corno della Copia . TjUndo cerne hMiamo già detto Ufrodt^tfricedogm hme^Ù ubbcndAnza nepoj^oli: Era lifcrtu tÌ9ne* Tt a fAX Note About Images Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.
Owner: Internet Archive Book Images
Views: 942
Tags: booksubjectemblems booksubjectfestivals booksubjecttriumphalarches bookcentury1600 booksubjectvirtues bookidilzodiacooveride00oril bookauthororiliafrancesco17thcent bookauthorscacciaventofrancescoantonio bookauthorbeltranoottaviofl1640 booksubjectalbaantonioalvarezdetoledoduquede15851639
1825

[Portrait of Bill (Buddy) De Arango, Terry Gibbs, and Harry Biss, Club Troubadour, New York, N.Y., between 1946 and 1948] (LOC)
Description: Gottlieb, William P., 1917-, photographer. [Portrait of Bill (Buddy) De Arango, Terry Gibbs, and Harry Biss, Club Troubadour, New York, N.Y., between 1946 and 1948] 1 negative : b&w ; 2 1/4 x 2 1/4 in. Notes: Gottlieb Collection Assignment No. 460 Purchase William P. Gottlieb Forms part of: William P. Gottlieb Collection (Library of Congress). Subjects: De Arango, Bill (Buddy) Gibbs, Terry, 1924- Biss, Harry Jazz musicians--1940-1950. Guitarists--1940-1950. Percussionists--1940-1950. Club Troubadour Format: Portrait photographs--1940-1950. Group portraits--1940-1950. Film negatives--1940-1950. Rights Info: Mr. Gottlieb has dedicated these works to the public domain, but rights of privacy and publicity may apply. lcweb2.loc.gov/diglib/ihas/html/gottlieb/gottlieb-copyrig... Repository: (negative) Library of Congress, Prints & Photographs Division, Washington D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: William P. Gottlieb Collection (DLC) 99-401005 General information about the Gottlieb Collection is available at lcweb2.loc.gov/diglib/ihas/html/gottlieb/gottlieb-home.html Persistent URL: hdl.loc.gov/loc.music/gottlieb.10801 Call Number: LC-GLB23- 1080
Owner: The Library of Congress
Views: 4893
Tags: libraryofcongress xmlns:dc=httppurlorgdcelements11 dc:identifier=httphdllocgovlocmusicgottlieb10801 clubtroubadour
1946

Gluck (LOC)
Description: Bain News Service,, publisher. Gluck [between ca. 1920 and ca. 1925] 1 negative : glass ; 5 x 7 in. or smaller. Notes: Photograph shows Romanian-American opera singer Alma Gluck (1884-1938) with a child. Title from data provided by the Bain News Service on the negative. Forms part of: George Grantham Bain Collection (Library of Congress). Format: Glass negatives. Rights Info: No known restrictions on publication. For more information, see George Grantham Bain Collection - Rights and Restrictions Information www.loc.gov/rr/print/res/274_bain.html Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Bain News Service photograph collection (DLC) 2005682517 General information about the George Grantham Bain Collection is available at hdl.loc.gov/loc.pnp/pp.ggbain Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/ggbain.35704 Call Number: LC-B2- 5964-1
Owner: The Library of Congress
Views: 2679
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpggbain35704
1920

Table Bay, Cape Town South Africa, c. 1861,
Description: Table Bay, Cape Town South Africa, c. 1861, Album of views, illustrations and Macarthur family photographs, 1857-1879, PXA 4358/Vol. 1, collection.sl.nsw.gov.au/record/nM7lp5AY/BB6l5Am3omyAO On 16 August 1860 HMS Herald left Australia on its return trip to England after nearly 9 years away. On the way back the ship passed through Cape Town in Feb 1861 and this image of the harbour was likely to have been taken around this time.
Owner: State Library of NSW
Views: 7214
Tags: tablebay southafrica royalnavy statelibraryofnewsouthwales sailingships arthur onslow 1860s albumen vintage
1861

J. Baptiste, hairdressing/barber's saloon, Hill End gold fields, ca. 1872
Description: J. Baptiste, hairdressing/barber's saloon, Hill End gold fields, New South Wales, ca. 1872, American & Australasian Photographic Company, from quarter plate glass negative, State Library of New South Wales, ON 4 Box 9 No 70020, collection.sl.nsw.gov.au/record/YdmeQJp9
Owner: State Library of NSW
Views: 17842
Tags: goldrush goldfields hillend newsouthwales statelibraryofnewsouthwales 1870s haridressing frenchinaustralia commercialbuildings shopfronts
1872

Dr. Mabel Elliott (LOC)
Description: Bain News Service,, publisher. Dr. Mabel Elliott [between ca. 1920 and ca. 1925] 1 negative : glass ; 5 x 7 in. or smaller. Notes: Photograph shows Dr. Mabel Elliott of the Near East Relief. Title from data provided by the Bain News Service on the negative. Caption continues: "Runs world's largest medical station." Forms part of: George Grantham Bain Collection (Library of Congress). Format: Glass negatives. Rights Info: No known restrictions on publication. For more information, see George Grantham Bain Collection - Rights and Restrictions Information www.loc.gov/rr/print/res/274_bain.html Repository: Library of Congress, Prints and Photographs Division, Washington, D.C. 20540 USA, hdl.loc.gov/loc.pnp/pp.print Part Of: Bain News Service photograph collection (DLC) 2005682517 General information about the George Grantham Bain Collection is available at hdl.loc.gov/loc.pnp/pp.ggbain Higher resolution image is available (Persistent URL): hdl.loc.gov/loc.pnp/ggbain.35611 Call Number: LC-B2- 5944-9
Owner: The Library of Congress
Views: 7312
Tags: libraryofcongress dc:identifier=httphdllocgovlocpnpggbain35611
1920